Details for Arabidopsis Locus AT3G18600

Position : Chr3 ( 5`- 6399571 .. 6403348 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18600

Protein [Map View]
MVESDKSSVEELKKRVRKRSRGKKNEQQKAEEKTHTVEENADETQKKSEKKVKKVRGKIEEEEEKVEAMEDGEDEKNIVI
VGKGIMTNVTFDSLDLSEQTSIAIKEMGFQYMTQIQAGSIQPLLEGKDVLGAARTGSGKTLAFLIPAVELLFKERFSPRN
GTGVIVICPTRELAIQTKNVAEELLKHHSQTVSMVIGGNNRRSEAQRIASGSNLVIATPGRLLDHLQNTKAFIYKHLKCL
VIDEADRILEENFEEDMNKILKILPKTRQTALFSATQTSKVKDLARVSLTSPVHVDVDDGRRKVTNEGLEQGYCVVPSKQ
RLILLISFLKKNLNKKIMVFFSTCKSVQFHTEIMKISDVDVSDIHGGMDQNRRTKTFFDFMKAKKGILLCTDVAARGLDI
PSVDWIIQYDPPDKPTEYIHRVGRTARGEGAKGKALLVLIPEELQFIRYLKAAKVPVKELEFNEKRLSNVQSALEKCVAK
DYNLNKLAKDAYRAYLSAYNSHSLKDIFNVHRLDLLAVAESFCFSSPPKVNLNIESGAGKVRKARKQQGRNGFSPYSPYG
KSTPTKEA*

DNA
ATGGTTGAATCGGACAAGTCATCCGTTGAAGAGCTGAAGAAGAGGGTTAGGAAGAGAAGCCGTGGGAAGAAGAATGAGCA
GCAAAAGGCTGAAGAAAAAACCCACACTGTAGAGGAAAACGCTGATGAAACGCAGAAGAAGAGTGAAAAGAAGGTTAAGA
AAGTGAGAGGCAAAATCGAGGAAGAGGAAGAAAAGGTGGAAGCAATGGAAGATGGTGAAGATGAGAAGAATATTGTGATT
GTCGGGAAAGGGATAATGACTAATGTGACTTTTGATTCCCTCGACTTATCTGAGCAAACTTCTATAGCTATCAAGGAGAT
GGGCTTTCAGTACATGACGCAAATTCAAGCTGGATCAATTCAGCCCCTTTTGGAGGGGAAGGATGTTCTTGGTGCTGCCA
GAACTGGTTCTGGTAAAACTCTTGCTTTTCTCATTCCGGCTGTTGAGTTGCTGTTTAAAGAGCGTTTCTCTCCTCGCAAC
GGGACTGGTGTGATTGTTATTTGCCCCACAAGGGAACTTGCTATCCAGACTAAAAATGTGGCGGAGGAGTTACTCAAGCA
TCATTCACAGACAGTCAGCATGGTTATTGGTGGCAATAACAGAAGGTCGGAAGCACAACGCATTGCCAGTGGTTCAAACT
TGGTGATAGCAACTCCTGGTCGTCTTCTTGACCATCTTCAGAATACAAAGGCTTTCATTTATAAACACTTGAAGTGCCTT
GTGATCGATGAAGCTGATAGGATACTGGAAGAGAATTTTGAGGAAGACATGAATAAGATTCTAAAGATTTTACCAAAGAC
TAGGCAAACTGCGTTATTCTCTGCCACCCAGACCTCTAAGGTTAAAGATCTTGCTCGGGTGTCATTGACATCACCTGTTC
ATGTGGATGTCGATGATGGCAGACGCAAGGTGACAAATGAAGGATTGGAGCAAGGCTATTGTGTTGTTCCGAGCAAACAA
AGACTTATCCTTCTAATTTCCTTTTTGAAAAAGAACCTAAATAAAAAGATTATGGTATTTTTCTCGACTTGCAAGTCGGT
ACAATTCCATACGGAAATCATGAAAATAAGCGACGTGGATGTCTCTGATATTCATGGAGGCATGGATCAGAACAGAAGAA
CTAAAACCTTTTTCGACTTCATGAAAGCAAAGAAAGGTATCTTGTTATGTACTGATGTTGCTGCTCGTGGTCTCGATATT
CCTTCCGTGGACTGGATTATACAGTATGATCCACCAGACAAGCCAACGGAATATATCCATAGGGTTGGTCGAACAGCCCG
TGGAGAAGGAGCAAAGGGAAAGGCATTACTTGTCTTGATTCCTGAAGAACTTCAGTTTATTCGCTACCTGAAGGCTGCGA
AAGTACCTGTTAAAGAGCTTGAGTTCAATGAGAAGAGGCTTAGTAATGTTCAATCTGCGCTGGAGAAATGTGTTGCCAAG
GACTACAATCTGAACAAGTTAGCCAAAGATGCGTACAGGGCTTATCTCTCAGCATACAATTCACACTCTTTGAAAGACAT
CTTTAATGTTCACCGACTTGACCTCCTGGCTGTTGCTGAATCGTTCTGCTTCTCTTCGCCGCCTAAAGTGAATCTGAACA
TAGAAAGTGGAGCTGGGAAGGTGAGGAAGGCGAGAAAGCAGCAAGGTCGCAATGGCTTCAGTCCTTACAGTCCCTATGGC
AAGTCCACACCTACAAAGGAGGCATAA