Details for Arabidopsis Locus AT3G18580

Position : Chr3 ( 5`- 6396931 .. 6398190 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18580

Protein [Map View]
MANSMATLSRRLYRSLLSNPRISQASMSFCTNNITSPEDSDFDELESPIEPKASDPVSRFSGEERVMEERPLENGLDSGI
FKAILVGQVGQLPLQKKLKSGRTVTLFSVGTGGIRNNRRPLINEDPREYASRSAVQWHRVSVYPERLADLVLKNVEPGTV
IYLEGNLETKIFTDPVTGLVRRIREVAIRRNGRVVFLGKAGDMQQPSSAELRGVGYY*

DNA
ATGGCGAATTCAATGGCTACACTTTCTAGAAGACTCTATCGATCTCTTCTATCGAACCCTAGAATTTCTCAAGCTTCCAT
GTCTTTCTGTACCAACAACATCACTTCCCCAGAAGACTCCGACTTTGACGAGTTAGAATCGCCCATTGAACCAAAGGCCT
CAGATCCAGTTTCTCGATTTTCCGGAGAAGAACGCGTTATGGAAGAGCGTCCACTCGAAAATGGCCTTGACTCTGGCATT
TTCAAGGCAATATTGGTGGGGCAAGTGGGTCAGCTTCCTCTGCAGAAGAAGCTTAAGAGTGGTAGAACTGTCACTCTCTT
CTCTGTAGGAACTGGTGGGATCAGGAACAACCGGAGACCGCTTATTAACGAAGATCCGAGAGAGTATGCGAGCCGGTCTG
CGGTGCAGTGGCACCGTGTCTCTGTTTACCCTGAACGCTTGGCAGATCTTGTGTTGAAGAATGTTGAACCCGGTACTGTT
ATCTACTTAGAGGGTAATCTGGAGACGAAGATATTCACTGATCCTGTCACTGGTTTGGTTCGACGTATAAGAGAAGTAGC
AATTCGTAGAAACGGCCGAGTTGTGTTTTTGGGAAAAGCCGGTGATATGCAGCAACCGAGTTCTGCTGAGCTTAGAGGCG
TTGGCTACTACTGA