Details for Arabidopsis Locus AT3G18570

Position : Chr3 ( 5`- 6395860 .. 6396606 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18570

Protein [Map View]
MAERFSSGEAQYWPNYGSTATTTVSNSPISSFFHQLRSHSPTSSQLFGFLALFISTGILLFLLGVSVTAAVLGFIVFLPL
IIISSPIWIPVFVVVGGFLTVSGFLVGTVALVSWTYRYFRGMHPVGSNQMDYARSRIYDTASHVKDYAREYGGYFHGRAK
DAAPGA*

DNA
ATGGCGGAAAGGTTCTCTAGCGGCGAGGCCCAATATTGGCCCAATTATGGTAGCACCGCCACCACCACCGTTAGCAACAG
CCCCATCTCGTCGTTTTTCCATCAGCTCCGATCCCATTCACCAACATCCTCGCAGCTCTTTGGTTTCCTCGCTCTCTTTA
TCTCCACTGGCATCCTCCTCTTCCTCCTTGGTGTAAGCGTCACCGCTGCCGTGCTCGGCTTCATTGTCTTTCTTCCATTG
ATCATCATCTCGAGTCCGATATGGATTCCCGTTTTTGTCGTCGTTGGCGGGTTCTTAACGGTCTCCGGATTTCTTGTCGG
AACGGTGGCTTTAGTGTCGTGGACGTACCGCTATTTCCGGGGAATGCACCCGGTTGGATCGAATCAGATGGATTATGCAC
GTAGTAGGATCTATGACACGGCATCTCACGTCAAAGATTACGCTAGAGAATACGGTGGTTACTTCCATGGCAGGGCTAAA
GATGCGGCCCCTGGTGCTTGA