Details for Arabidopsis Locus AT3G18520

Position : Chr3 ( 5`- 6361176 .. 6365615 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18520

Protein [Map View]
MVVETIERSCEGSKRRHVNGGDIAVPCSGEECSNGDINVAPGVSAKRARVSREMTFEDIYGADALLNDDDDEDDDCDWEP
VQAPMEFVKWCCVNCTMSNPGDMVHCCICGEHKESGILRHGYLASPFFKDTGLIEVEEKYGGSSSATSSTAVGFDERMLL
HSEFEVKAQPHPERPDRLRAIAASLATAGVFPGRCLPINAREITKQELQMVHTSEHVDAVDTTSQLLYSYFTSDTYANEY
SARAARLAAGLCADLATDIFTGRVKNGFALVRPPGHHAGVRHAMGFCLHNNAAVAALVAQAAGAKKVLIVDWDVHHGNGT
QEIFEQNKSVLYISLHRHEGGNFYPGTGAADEVGSNGGEGYCVNVPWSCGGVGDKDYIFAFQHVVLPIASAFSPDFVIIS
AGFDAARGDPLGCCDVTPAGYSRMTQMLGDLCGGKMLVILEGGYNLRSISASATAVIKVLLGENPENELPIATTPSVAGL
QTVLDVLNIQLEFWPSLAISYSKLLSELEARLIENKSEKSDEKEGCSGSDMVEMGTKEAFVQLSLGSYDFKIKVILESIL
PNPS*

DNA
ATGGTTGTAGAAACTATCGAGAGGTCTTGTGAGGGTTCAAAGAGAAGACATGTGAACGGTGGAGATATCGCTGTTCCTTG
TTCGGGAGAAGAGTGTAGCAATGGAGATATAAATGTAGCTCCTGGAGTTTCAGCGAAAAGAGCTAGGGTTTCTAGAGAAA
TGACGTTTGAAGATATTTACGGTGCTGATGCATTACTCAATGATGACGATGATGAGGATGATGATTGTGATTGGGAACCT
GTGCAGGCGCCTATGGAGTTTGTAAAATGGTGTTGTGTCAATTGCACTATGTCGAACCCTGGTGATATGGTCCACTGTTG
TATATGCGGTGAGCACAAGGAATCTGGCATTTTGAGGCATGGATATTTAGCGTCTCCCTTTTTTAAAGACACTGGTCTCA
TTGAAGTCGAGGAGAAATATGGAGGAAGCTCATCTGCAACCAGCTCGACAGCTGTTGGGTTCGACGAGAGAATGTTGCTA
CACTCAGAATTTGAAGTGAAGGCACAACCACATCCAGAGAGACCTGATCGTCTTCGAGCTATAGCTGCTAGTCTTGCCAC
AGCTGGTGTTTTTCCTGGAAGATGCTTGCCTATCAATGCAAGGGAAATCACGAAACAAGAACTCCAGATGGTCCACACTT
CAGAGCATGTTGATGCTGTTGATACTACAAGCCAGCTTCTCTATAGCTACTTCACCTCTGACACATATGCTAATGAGTAT
TCAGCACGTGCTGCTAGACTTGCAGCAGGTTTGTGCGCTGATCTAGCTACAGATATTTTCACTGGCCGTGTAAAAAATGG
TTTTGCTTTGGTTAGACCTCCCGGTCATCATGCTGGCGTCAGGCATGCTATGGGGTTTTGCCTTCACAATAATGCAGCCG
TTGCTGCATTAGTAGCACAAGCAGCAGGGGCAAAGAAGGTGCTGATTGTGGACTGGGATGTCCATCATGGCAACGGAACC
CAAGAGATATTCGAACAAAACAAATCTGTATTGTACATATCCTTGCACAGACATGAGGGAGGAAACTTCTATCCCGGTAC
TGGAGCTGCTGATGAGGTTGGTTCTAATGGTGGGGAAGGTTATTGTGTAAATGTTCCATGGAGTTGCGGTGGAGTTGGGG
ATAAAGACTATATCTTTGCGTTTCAACATGTGGTTCTCCCCATAGCTTCTGCATTTTCTCCAGATTTTGTCATCATATCT
GCGGGATTTGATGCGGCTAGAGGAGACCCACTAGGATGCTGTGATGTGACTCCGGCTGGCTATTCTCGAATGACACAGAT
GTTGGGTGATCTGTGTGGTGGGAAAATGCTAGTTATTCTCGAGGGCGGCTACAATCTTCGCTCCATATCTGCTTCTGCAA
CAGCAGTGATCAAGGTGCTTCTGGGTGAAAATCCGGAGAACGAGTTGCCCATCGCCACCACGCCTTCAGTAGCCGGCCTG
CAAACTGTTCTTGATGTACTGAATATCCAACTGGAGTTCTGGCCATCACTTGCTATCAGCTACTCCAAATTACTCTCAGA
GTTGGAAGCACGTCTGATCGAAAACAAAAGTGAAAAATCAGATGAAAAGGAAGGTTGTTCGGGTTCCGACATGGTGGAAA
TGGGGACGAAAGAAGCTTTTGTACAACTTTCTCTCGGCTCGTATGATTTCAAGATCAAAGTGATTTTAGAAAGCATTCTT
CCTAATCCGTCGTAG