Details for Arabidopsis Locus AT3G18518

Position : Chr3 ( 5`- 6360135 .. 6360296 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18518

Protein [Map View]
MREKYTKEEAVKNWEKKKNKPSSPKGVGEFLKKKKGRFYIIGKCITMLLCSHK*

DNA
ATGAGGGAGAAGTACACAAAGGAGGAAGCAGTGAAGAATTGGGAGAAGAAGAAGAACAAGCCTTCTTCACCAAAAGGAGT
TGGAGAGTTTCTGAAAAAGAAGAAAGGAAGGTTCTACATTATTGGAAAATGTATTACTATGCTTCTTTGTTCACACAAGT
GA