Details for Arabidopsis Locus AT3G18510

Position : Chr3 ( 5`- 6355664 .. 6356153 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18510

Protein [Map View]
MALSSMTWGYARIIAGTLLGGALGFYVMHRIEVSYKMRMEEALNQYEKDMQKRQEEENLIQINEESV*

DNA
ATGGCGTTGAGCTCAATGACATGGGGTTACGCACGGATCATAGCTGGAACACTTCTCGGCGGGGCCCTCGGATTCTACGT
AATGCATCGCATCGAAGTTAGCTACAAGATGAGGATGGAGGAAGCGTTGAATCAATACGAGAAGGATATGCAGAAGAGAC
AAGAAGAAGAAAATCTTATTCAGATCAATGAAGAATCTGTTTAG