Details for Arabidopsis Locus AT3G18500

Position : Chr3 ( 5`- 6352477 .. 6355442 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18500

Protein [Map View]
MRCVNRVDCSWSRPSEAYRILPSGGHLSSGFHQCPLSSLSFRSSFVCCSSSTSGPSDSNPESSSNRSYSRRWQNPLPRRQ
HPDQIPSSQIARDWIDSDTTPVSQALERFTVVSYNILGDGNSSYHRELYSNVSVPYLKWGYRKRLICEELIRLNPDIISM
QEVDKYFDLFSMMEKAGYAGSYKRRTGDNVDGCAMFWKADRFGVLERENIEFSQFGMRDNVAQLAVLELRKSNKSRKILL
GNIHVLYNPNQGDVKLGQVRSLCSKAHLLSKKWGDIPIVLCGDFNSTPKSPLYNFLASSELNVMEHDKKELSGQKNCRPT
KVLETGSKSSNTITFRSFCSSWTKEEIRVATGQENSYWAAHPLKLNSSYASVKGSANTRDSVGEPLATSYHSKFLGTVDY
LWYSDGLLPARVLDTLPIDVLCKTKGLPCQELGSDHLALVSEFVFEPDG*

DNA
ATGCGTTGTGTGAATCGCGTTGATTGTTCTTGGTCACGGCCAAGCGAAGCTTACCGTATCTTACCCTCCGGTGGTCACCT
TTCATCTGGATTCCATCAATGTCCTTTATCGTCTCTATCTTTCCGTTCCTCTTTCGTGTGTTGCTCCTCCTCCACATCTG
GACCGTCCGATTCAAATCCCGAATCATCTTCAAATCGCTCTTACAGCCGTAGATGGCAGAATCCTCTTCCCCGGCGTCAA
CATCCCGATCAAATACCGTCTTCTCAGATTGCTCGTGATTGGATCGATTCAGATACAACTCCAGTTTCTCAAGCTTTAGA
GAGATTCACTGTAGTGTCGTACAACATATTGGGAGATGGAAATTCATCATATCACAGAGAGTTGTACTCCAATGTGTCTG
TTCCTTACCTCAAGTGGGGCTACCGCAAAAGGTTGATATGCGAAGAACTCATTCGTCTCAATCCAGACATAATCTCTATG
CAGGAAGTAGATAAATATTTTGATCTATTCAGTATGATGGAGAAAGCTGGATATGCTGGCTCCTATAAGCGGCGAACTGG
AGATAACGTCGATGGTTGCGCAATGTTTTGGAAGGCTGACAGGTTTGGAGTTTTGGAGAGGGAAAACATTGAGTTTAGCC
AGTTTGGTATGCGGGATAATGTTGCACAGCTTGCTGTTCTTGAGCTCCGGAAGTCTAATAAGTCAAGAAAGATACTGCTG
GGTAACATTCACGTGCTTTATAATCCAAATCAAGGAGATGTGAAGCTGGGTCAGGTCCGTTCACTCTGCTCAAAGGCTCA
CTTGCTCTCTAAGAAATGGGGTGACATTCCCATTGTTCTATGCGGAGATTTCAATAGCACTCCCAAGAGTCCATTGTACA
ACTTCTTGGCGTCCTCTGAGCTGAATGTCATGGAACATGACAAAAAAGAGCTGTCCGGCCAGAAAAATTGTCGTCCTACC
AAAGTTCTTGAAACTGGTAGCAAATCCAGTAATACAATAACTTTCAGAAGTTTTTGTAGCTCTTGGACAAAAGAAGAGAT
CCGTGTCGCAACCGGGCAAGAGAACTCGTACTGGGCTGCGCATCCTCTGAAACTCAATAGCTCATACGCCTCAGTTAAGG
GCTCAGCAAATACCAGGGACTCTGTTGGTGAACCTCTAGCAACCTCATATCACTCGAAATTTCTCGGAACGGTTGATTAT
CTCTGGTACTCTGATGGTCTTTTACCTGCAAGAGTTCTTGACACACTTCCTATTGATGTTCTATGCAAAACCAAAGGCCT
TCCTTGTCAAGAATTGGGAAGCGATCACTTGGCTCTTGTTTCTGAATTTGTCTTTGAACCGGACGGTTAA