Details for Arabidopsis Locus AT3G18450

Position : Chr3 ( 5`- 6331034 .. 6332218 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18450

Protein [Map View]
MGRPVGQTNQAQPSVQHTASPSNKVSHNGGIGKPANIPTGIPVNYQQTQNQWSSQLFDCMNDSENAVITLIAPCVTFGQI
AEIVDEGATPCATAGLLYGALFFTGASFVYSYMFRARIRKKFGLPDAPAPDWITHLVCMPFALCQEYRELKHHGFDPILG
WAGNVQQAQQQEMMTPPTGQRMMG*

DNA
ATGGGTCGACCAGTTGGCCAAACGAATCAGGCACAACCTTCGGTTCAACATACGGCTAGCCCGAGCAACAAGGTATCCCA
TAACGGTGGAATTGGTAAGCCGGCAAACATACCAACGGGCATACCGGTCAATTACCAACAAACACAAAATCAGTGGAGTT
CTCAACTTTTCGATTGCATGAACGACAGTGAAAATGCCGTGATCACATTGATAGCTCCATGCGTCACGTTCGGACAGATT
GCGGAGATCGTTGACGAAGGCGCGACGCCTTGTGCGACAGCTGGGTTGTTGTACGGAGCACTATTTTTTACCGGGGCAAG
TTTTGTGTATTCATACATGTTCAGGGCCAGGATACGAAAGAAGTTCGGGTTACCGGATGCTCCGGCTCCCGATTGGATCA
CTCACTTAGTCTGTATGCCGTTTGCTCTTTGTCAAGAGTATCGTGAGCTCAAGCACCATGGTTTTGACCCCATTCTTGGG
TGGGCTGGGAATGTTCAACAAGCACAGCAGCAAGAGATGATGACCCCTCCAACAGGTCAACGAATGATGGGTTGA