Details for Arabidopsis Locus AT3G18440

Position : Chr3 ( 5`- 6328115 .. 6330794 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18440

Protein [Map View]
MAAKQGSFRHGILEKRERLLSNNGFSDFRFTDIESNDLLENENCGRRTRLCCCCSCGNLSEKISGVYDDAKDVARKAWEM
GVSDPRKIVFSAKIGLALTIVALLIFYQEPNPDLSRYSVWAILTVVVVFEFTIGATLSKGFNRALGTLSAGGLALGMAEL
STLFGDWEEIFCTLSIFCIGFLATFMKLYPSMKAYEYGFRVFLLTYCYILISGFRTGQFIEVAISRFLLIALGAGVSLGV
NMFIYPIWAGEDLHNLVVKNFMNVATSLEGCVNGYLRCLEYERIPSKILTYQASEDPVYKGYRSAVESTSQEESLMSFAI
WEPPHGPYKSFNYPWKNYVKLSGALKHCAFTVMALHGCILSEIQAPEERRQVFRQELQRVGVEGAKLLRELGEKVKKMEK
LGPVDLLFEVHLAAEELQHKIDKKSYLLVNSECWEIGNRATKESEPQELLSLEDSDPPENHAPPIYAFKSLSEAVLEIPP
SWGEKNHREALNHRPTFSKQVSWPARLVLPPHLETTNGASPLVETTKTYESASALSLATFASLLIEFVARLQNVVDAFKE
LSQKANFKEPEIVTTGTDVEFSGERVGLGQKIRRCFGM*

DNA
ATGGCGGCGAAGCAAGGTTCCTTCAGGCATGGAATACTCGAGAAACGGGAGAGGCTTCTCTCCAATAATGGTTTCTCCGA
TTTCAGATTCACCGACATCGAATCTAACGATCTACTCGAAAACGAAAACTGTGGACGAAGAACACGGTTATGTTGCTGTT
GTTCGTGTGGTAATCTATCTGAGAAAATATCTGGAGTCTACGACGATGCTAAAGATGTAGCGAGGAAAGCTTGGGAGATG
GGAGTATCTGATCCGAGAAAGATCGTCTTCTCCGCTAAGATTGGTCTTGCTCTGACGATTGTTGCGCTTTTGATTTTTTA
TCAGGAACCTAATCCGGATCTTAGTCGATACTCTGTTTGGGCTATTCTTACTGTCGTCGTCGTCTTCGAATTCACCATCG
GAGCAACTCTAAGCAAAGGGTTTAATAGAGCGCTTGGGACATTATCAGCTGGAGGTCTTGCTCTTGGAATGGCTGAGCTT
TCCACTTTATTCGGTGACTGGGAAGAGATCTTCTGCACTCTTAGTATCTTCTGCATTGGGTTTCTTGCAACTTTCATGAA
ACTATACCCGTCGATGAAAGCTTATGAATACGGGTTCCGGGTTTTCTTGCTTACGTATTGCTACATTCTGATTTCTGGGT
TCAGAACTGGGCAGTTTATAGAAGTGGCTATCTCTCGGTTTCTGCTTATAGCTCTTGGTGCTGGTGTTAGTTTAGGTGTT
AATATGTTTATCTATCCTATATGGGCTGGAGAGGATCTTCATAACCTTGTCGTGAAGAATTTTATGAATGTTGCGACTTC
CCTTGAAGGTTGTGTGAATGGATATCTCCGCTGTCTTGAATACGAGAGAATCCCATCCAAAATCCTCACGTACCAAGCTT
CAGAGGATCCTGTTTACAAGGGTTATAGATCAGCTGTTGAGTCAACCAGCCAAGAAGAGTCTCTGATGAGTTTCGCAATA
TGGGAGCCACCACATGGACCATACAAGTCATTTAACTACCCATGGAAGAACTATGTCAAGCTCAGCGGCGCTCTCAAGCA
TTGTGCATTCACTGTCATGGCATTGCACGGCTGCATTCTCTCAGAAATCCAGGCACCAGAGGAACGGAGACAAGTTTTTC
GGCAAGAACTTCAGAGAGTGGGCGTAGAAGGAGCTAAATTGTTAAGAGAGCTCGGTGAAAAGGTGAAGAAGATGGAGAAG
CTAGGACCAGTCGACCTTCTCTTTGAAGTACACCTAGCTGCTGAAGAATTACAGCACAAGATCGACAAGAAATCTTACCT
TCTTGTCAATTCCGAATGCTGGGAGATCGGAAACCGAGCCACCAAGGAATCAGAGCCTCAAGAACTGCTCTCCCTCGAAG
ATTCAGATCCACCAGAAAACCACGCGCCTCCAATCTACGCCTTCAAATCCCTAAGCGAGGCAGTTCTAGAGATACCACCA
AGCTGGGGCGAGAAGAATCACCGTGAAGCGTTGAACCATAGACCTACTTTCTCAAAACAGGTGTCATGGCCTGCACGGCT
TGTACTTCCGCCGCATCTGGAGACGACTAACGGAGCTTCACCGTTGGTGGAGACAACAAAGACTTATGAAAGCGCGAGTG
CATTGTCTCTCGCGACGTTCGCGTCTCTCCTCATTGAGTTCGTTGCTCGGTTGCAGAACGTGGTCGACGCGTTCAAGGAG
TTAAGCCAGAAAGCGAATTTCAAGGAGCCGGAGATTGTTACAACGGGGACTGATGTTGAATTCTCTGGTGAAAGAGTTGG
ACTTGGCCAGAAGATTCGTAGGTGTTTTGGGATGTAA