Details for Arabidopsis Locus AT3G18430

Position : Chr3 ( 5`- 6325915 .. 6327692 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18430

Protein [Map View]
MGNTSSMLTQYDIEEVQSHCHDLFEQQEILSLYQRFCQLDRNAKGFISADEFLSVPEFAMNPLSQRLLKMVDGLNFKDFV
AFLSAFSAKASLRQKVQLIFKVYDSDCNGKVSFKDIMEVLRDLSGSFMSDEQREQVLSQVLKESGYTSDSFLTLEDFIKI
FGSSRPEMDVEIPVD*

DNA
ATGGGGAATACTTCATCGATGCTGACTCAGTACGACATCGAAGAAGTTCAGAGTCATTGTCATGATCTATTTGAGCAGCA
GGAGATTTTATCTCTGTATCAACGGTTTTGCCAGTTAGATCGAAACGCAAAAGGATTTATATCTGCTGATGAGTTTCTCT
CTGTGCCTGAGTTTGCGATGAATCCACTCTCTCAGAGGCTGCTTAAGATGGTTGATGGTTTGAACTTTAAGGATTTTGTT
GCTTTCTTGTCTGCGTTTAGTGCCAAGGCTAGTCTAAGACAGAAAGTTCAATTGATCTTTAAAGTCTATGATTCGGACTG
CAACGGGAAGGTCTCTTTTAAAGATATCATGGAAGTGTTGCGTGACTTATCGGGATCATTCATGTCTGATGAGCAAAGAG
AGCAAGTACTGAGCCAGGTTTTGAAGGAATCGGGCTACACGAGTGACTCATTCTTAACTCTGGAGGATTTCATAAAGATC
TTTGGGAGTAGTAGACCGGAGATGGACGTTGAAATTCCTGTGGATTAG