Details for Arabidopsis Locus AT3G18400

Position : Chr3 ( 5`- 6318745 .. 6320593 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18400

Protein [Map View]
MEENLPPGFRFHPTDEELITHYLCRKVSDIGFTGKAVVDVDLNKCEPWDLPAKASMGEKEWYFFSQRDRKYPTGLRTNRA
TEAGYWKTTGKDKEIYRSGVLVGMKKTLVFYKGRAPKGEKSNWVMHEYRLESKQPFNPTNKEEWVVCRVFEKSTAAKKAQ
EQQPQSSQPSFGSPCDANSSMANEFEDIDELPNLNSNSSTIDYNNHIHQYSQRNVYSEDNTTSTAGLNMNMNMASTNLQS
WTTSLLGPPLSPINSLLLKAFQIRNSYSFPKEMIPSFNHSSLQQGVSNMIQNASSSSQVQPQPQEEAFNMDSIW*

DNA
ATGGAAGAAAATCTTCCTCCGGGGTTCAGATTTCATCCTACAGACGAGGAGCTCATAACGCATTATCTATGTCGGAAAGT
CTCCGATATAGGATTCACCGGTAAAGCTGTCGTCGACGTTGATCTCAACAAGTGTGAACCTTGGGATTTGCCAGCCAAGG
CTTCAATGGGAGAGAAAGAGTGGTATTTCTTCAGCCAAAGGGATCGGAAATATCCAACCGGTTTAAGAACAAACCGGGCA
ACAGAAGCTGGTTACTGGAAAACCACCGGGAAAGATAAAGAAATATACCGAAGTGGAGTGTTGGTTGGGATGAAGAAAAC
CCTAGTTTTCTACAAAGGAAGAGCTCCCAAAGGTGAGAAAAGCAATTGGGTTATGCATGAGTACAGGCTTGAGAGCAAAC
AACCTTTCAACCCCACGAATAAGGAGGAATGGGTAGTGTGTAGGGTTTTCGAAAAGAGCACGGCAGCAAAGAAAGCACAA
GAACAACAACCTCAATCTTCTCAACCATCTTTTGGATCTCCATGCGATGCAAACTCATCAATGGCAAATGAGTTTGAAGA
TATTGATGAGCTTCCGAATCTGAATTCAAACTCATCAACCATCGATTACAATAATCATATCCATCAATATTCGCAACGCA
ATGTTTACTCAGAAGACAACACAACAAGTACGGCTGGTCTCAACATGAACATGAACATGGCTAGTACTAATCTTCAGTCT
TGGACAACAAGTCTCCTTGGTCCGCCTTTATCTCCAATCAACTCTTTGTTGCTCAAGGCTTTCCAAATCAGGAACTCTTA
TAGTTTCCCAAAAGAGATGATCCCCAGTTTCAATCATTCTTCTCTTCAACAAGGAGTCTCCAATATGATCCAAAATGCTT
CAAGTTCGTCTCAAGTGCAACCCCAACCGCAAGAGGAAGCGTTTAATATGGACTCCATATGGTGA