Details for Arabidopsis Locus AT3G18390

Position : Chr3 ( 5`- 6313485 .. 6317971 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18390

Protein [Map View]
MALAPLNFTEMPLRSSLPLTSSSRYCSSPSLHALLFYSLGVKPSRQQIVRPFSSLRTSERSNNRSNNNRRLDQRNHKPTP
PWIDKWPPSSSGAGGDHAGKKGGENNGGDRIRSAEEEAEAKLRYLEKDKGQNAIERIVLRLRNLGLGSDDEDDVEDDEGG
GINGGDVKPVTGEERLGDLLKREWVRPDMMLAEGEESEEEDEVLLPWEKNEEEQAAERVVGEGGVAVMQKRRARAPSLAE
LTVEDSELRRLRRDGMYLRVRINIPKAGLTQAVMEKIYDTWRKEELVRLKFHEVLARDMKTAHEIVERRTGGMVIWRAGS
VMVVYRGLDYKGPPVISNQMAGPKETLFVPDVSSAGDEATNAKDNQSAPLVIKDPIIKNPIRKENMTEEEVEFNSLLDSL
GPRFQEWWGTGVLPVDADLLPPTIPGYKTPFRLLPTGMRSNLTNAEMTNLRKIGKTLPCHFALGRNRNHQGLAAAILQIW
EKSLIAKIAVKRGIQNTNNKLMADEVKTLTGGVLLLRNKYYIVIYRGKDFLPSSVAATLAERQELTKEIQDVEERVRNRE
IEAVQPVGDKVPAEAGTLAEFYEAQARWGKEITPDHREKMIEEASRVANARVVKRIQHKLNLAQSKFQRAEKLLSKIEAS
MIPNGPDYDQEVISEEERAMFRKVGLKMKAYLPIGIRGVFDGVIENMHLHWKHRELVKLISKQKNQAFVEETARLLEYES
GGVLVAIEKVPKGFALIYYRGKNYRRPISLRPRNLLTKAKALKRSIAMQRHEALSQHISELERTIEQMQSQLTSKNPSYS
ESEWENDEDDDDDEEEEKDDVEDNESDWDETDGESAISSIEEADMSSR*

DNA
ATGGCTTTGGCTCCACTTAATTTTACGGAAATGCCACTGAGAAGCTCTCTTCCTCTGACCTCTAGCTCTCGCTATTGTTC
CTCTCCTTCGCTTCACGCATTGCTCTTCTATTCGTTGGGTGTGAAACCCTCGCGTCAACAAATTGTTCGGCCATTCTCTT
CGCTGCGTACAAGCGAGCGTAGCAACAACAGGAGCAATAACAATCGTCGATTAGATCAACGTAATCATAAACCTACTCCT
CCTTGGATAGATAAGTGGCCTCCGTCATCCTCCGGAGCTGGCGGTGATCATGCCGGGAAGAAAGGTGGTGAAAACAACGG
CGGAGATAGAATTCGGTCTGCGGAGGAGGAAGCGGAAGCGAAACTTCGGTATTTGGAGAAGGATAAAGGACAAAACGCGA
TTGAGAGGATTGTTCTTCGGCTACGGAATTTAGGATTAGGTTCGGATGATGAGGACGATGTGGAAGATGACGAGGGAGGT
GGAATTAACGGCGGAGATGTGAAGCCGGTGACTGGAGAAGAGAGATTGGGGGATTTGTTGAAGAGAGAGTGGGTGAGACC
TGATATGATGCTTGCTGAGGGAGAAGAGAGTGAGGAAGAGGATGAGGTATTATTGCCATGGGAGAAAAATGAGGAAGAGC
AGGCGGCGGAGAGAGTAGTAGGAGAAGGAGGAGTGGCGGTGATGCAGAAGAGGAGAGCTAGAGCTCCATCACTGGCGGAG
CTCACCGTTGAGGATTCTGAGTTACGGCGGTTAAGGAGGGATGGAATGTATCTGAGGGTTAGGATCAATATACCAAAAGC
TGGGCTAACGCAGGCAGTGATGGAGAAGATTTATGATACTTGGAGGAAAGAAGAGCTTGTGAGGCTAAAGTTCCACGAAG
TGCTTGCTCGTGACATGAAGACGGCCCATGAGATTGTTGAGCGTCGAACTGGTGGAATGGTGATATGGAGGGCCGGAAGT
GTAATGGTGGTTTATCGTGGACTTGACTATAAAGGACCTCCTGTGATCTCTAATCAAATGGCCGGTCCTAAAGAGACTCT
TTTTGTCCCAGATGTATCTTCTGCTGGCGATGAAGCAACAAATGCCAAAGATAACCAAAGTGCACCTTTGGTAATCAAAG
ATCCGATCATCAAGAACCCTATTCGCAAAGAGAATATGACAGAAGAAGAAGTTGAATTTAACAGTCTATTAGACAGCTTA
GGTCCACGTTTTCAAGAGTGGTGGGGTACTGGGGTACTACCTGTGGACGCTGACTTACTACCTCCTACAATTCCTGGTTA
TAAAACACCTTTCAGGCTTCTTCCTACTGGGATGAGATCAAATTTGACCAATGCCGAAATGACAAATCTCAGGAAGATTG
GTAAAACTCTCCCATGCCATTTTGCTCTTGGTAGGAACAGAAATCACCAAGGATTGGCAGCTGCAATACTCCAGATCTGG
GAGAAAAGTCTAATTGCAAAGATCGCTGTGAAGCGAGGTATCCAGAATACAAATAACAAACTAATGGCGGATGAAGTGAA
GACATTGACAGGGGGTGTCTTGCTGCTCAGAAATAAGTATTACATTGTAATATATCGTGGGAAGGACTTCCTTCCTTCAA
GTGTGGCAGCTACTTTAGCAGAAAGACAAGAATTAACGAAAGAGATTCAAGATGTCGAAGAGAGGGTAAGAAATCGTGAG
ATTGAGGCTGTTCAGCCTGTTGGTGACAAAGTACCAGCAGAAGCTGGCACTCTGGCCGAGTTTTATGAGGCTCAAGCCCG
ATGGGGGAAGGAAATAACTCCAGACCATCGTGAAAAGATGATTGAAGAAGCTTCAAGGGTTGCAAATGCTAGAGTTGTTA
AACGAATACAACACAAACTAAACCTTGCCCAATCGAAGTTTCAAAGAGCAGAGAAACTGTTGTCCAAAATAGAAGCCTCT
ATGATTCCAAATGGACCTGATTATGATCAAGAGGTCATCTCCGAGGAAGAAAGAGCTATGTTCCGGAAAGTGGGACTGAA
AATGAAGGCATACTTACCCATAGGTATCCGTGGTGTATTTGATGGAGTCATTGAGAACATGCATCTGCATTGGAAACACA
GAGAATTGGTGAAGCTTATATCAAAACAGAAGAACCAAGCATTTGTTGAGGAGACAGCCCGGTTACTAGAATACGAGAGT
GGTGGAGTTCTTGTGGCAATAGAAAAGGTTCCTAAAGGATTTGCGCTTATTTATTACCGTGGGAAGAATTACAGGAGACC
CATTAGCTTGAGACCAAGGAATCTTCTGACAAAAGCAAAAGCATTGAAACGTTCCATTGCAATGCAACGCCACGAGGCAC
TTAGTCAGCATATTTCTGAACTGGAGAGAACAATAGAGCAAATGCAAAGCCAACTCACTTCGAAAAACCCGTCATACAGT
GAATCAGAATGGGAGAACGATGAGGATGATGATGATGATGAAGAAGAAGAGAAAGATGATGTGGAGGATAATGAGAGTGA
TTGGGATGAAACTGATGGCGAATCTGCAATTTCTAGTATCGAAGAAGCTGATATGTCATCGCGCTAA