Details for Arabidopsis Locus AT3G18370

Position : Chr3 ( 5`- 6305975 .. 6310620 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18370

Protein [Map View]
MGRRIKRKGLINTEAAREFINHLVAERHSLLLLVPLVLAFWAIERWVFAFSNWVPLVVAVWASLQYGSYQRALLAEDLTK
KWRQTVFNASTITPLEHCQWLNKLLSEIWLNYMNKKLSLRFSSMVEKRLRQRRSRLIENIQLLEFSLGSCPPLLGLHGTC
WSKSGEQKIMRLDFNWDTTDLSILLQAKLSMPFNRTARIVVNSLCIKGDILIRPILEGRALLYSFVSNPEVRIGVAFGGG
GGQSLPATELPGVSSWLVKILTETLNKKMVEPRRGCFSLPATDLHKTAIGGIIYVTVVSGNNLNRRILRGSPSKSSEIGE
GSSGNSSSKPVQTFVEVELEQLSRRTEMKSGPNPAYQSTFNMILHDNTGTLKFNLYENNPGSVRYDSLASCEVKMKYVGD
DSTMFWAVGSDNGVIAKHAEFCGQEIEMVVPFEGVSSGELTVRLLLKEWHFSDGSHSLNSVNSSSLHSLDSSSALLSKTG
RKIIVTVLAGKNLVSKDKSGKCDASVKLQYGKIIQKTKIVNAAECVWNQKFEFEELAGEEYLKVKCYREEMLGTDNIGTA
TLSLQGINNSEMHIWVPLEDVNSGEIELLIEALDPEYSEADSSKGLIELVLVEARDLVAADIRGTSDPYVRVQYGEKKQR
TKVIYKTLQPKWNQTMEFPDDGSSLELHVKDYNTLLPTSSIGNCVVEYQGLKPNETADKWIILQGVKHGEVHVRVTRKVT
EIQRRASAGPGTPFNKALLLSNQMKQVMIKFQNLIDDGDLEGLAEALEELESLEDEQEQYLLQLQTEQSLLINKIKDLGK
EILNSSPAQAPSRDS*

DNA
ATGGGTCGGAGAATAAAGAGGAAAGGTCTGATAAACACGGAAGCTGCAAGAGAATTTATCAATCATCTAGTTGCTGAGAG
GCATTCGCTGTTGTTGCTGGTTCCTTTGGTCTTAGCTTTCTGGGCAATTGAAAGATGGGTCTTTGCTTTCTCCAATTGGG
TTCCTCTCGTTGTCGCCGTCTGGGCTTCTCTTCAGTATGGAAGTTACCAAAGGGCACTACTTGCAGAAGATCTAACCAAG
AAGTGGAGGCAAACCGTTTTCAATGCGTCGACGATAACTCCATTGGAACATTGTCAATGGCTGAACAAGTTACTGTCTGA
AATTTGGCTAAACTATATGAACAAGAAACTCTCTCTTAGGTTTTCTTCTATGGTGGAGAAACGATTGAGGCAACGAAGAT
CAAGATTAATCGAAAATATACAATTGTTGGAGTTTTCTCTTGGCTCATGCCCTCCTTTGCTAGGACTACATGGAACTTGT
TGGTCAAAATCAGGGGAACAGAAAATCATGCGATTGGATTTCAACTGGGACACAACGGATCTAAGTATTTTGTTGCAAGC
CAAGTTATCCATGCCGTTTAATCGAACAGCACGAATCGTTGTCAACAGTCTCTGCATCAAGGGAGATATTCTGATCAGAC
CGATTCTTGAAGGAAGAGCATTGCTTTATTCCTTTGTATCGAATCCTGAAGTTAGAATCGGAGTTGCTTTCGGTGGTGGC
GGTGGCCAATCTCTCCCCGCTACAGAGCTTCCTGGTGTCTCCTCTTGGCTGGTAAAGATTCTAACGGAAACTTTGAACAA
GAAGATGGTAGAGCCACGCCGGGGATGTTTCTCGTTACCCGCAACAGATCTTCACAAAACAGCCATCGGGGGAATTATCT
ACGTAACCGTTGTATCTGGTAACAATCTTAACCGCAGAATTCTTCGGGGAAGCCCCTCGAAAAGTTCTGAGATCGGAGAA
GGTAGCAGCGGAAATAGCAGCAGCAAACCTGTTCAAACATTTGTGGAGGTCGAACTCGAGCAACTTTCTCGACGAACCGA
GATGAAGTCAGGACCGAATCCAGCTTATCAGTCGACATTTAACATGATCTTACACGACAATACAGGGACACTCAAGTTTA
ACCTCTATGAAAATAATCCTGGGAGTGTCAGATATGACAGTCTCGCTAGCTGTGAAGTTAAGATGAAATATGTAGGTGAT
GATTCAACGATGTTTTGGGCCGTTGGATCTGATAACGGTGTGATTGCAAAACACGCTGAGTTCTGTGGTCAAGAAATCGA
GATGGTTGTTCCGTTTGAAGGAGTTAGCTCCGGAGAGTTGACTGTCCGGCTACTTCTAAAAGAATGGCACTTCTCTGATG
GCTCACATAGCTTGAATAGCGTTAATTCGAGTTCATTACACTCCCTCGACAGCTCGTCTGCCCTCCTCTCGAAAACCGGC
CGGAAAATTATCGTGACGGTTTTGGCTGGAAAGAACCTTGTTTCTAAAGATAAGTCCGGAAAATGTGATGCCTCTGTCAA
GTTACAGTACGGAAAAATTATACAAAAGACGAAGATAGTGAACGCAGCAGAGTGTGTGTGGAACCAGAAATTTGAGTTCG
AAGAGTTAGCCGGAGAAGAATATTTAAAGGTGAAATGCTATAGAGAAGAGATGCTTGGCACGGACAACATCGGTACAGCT
ACATTGAGTCTTCAAGGAATCAATAACAGCGAAATGCATATATGGGTTCCGCTTGAAGATGTTAATTCTGGAGAAATAGA
GCTTTTGATCGAAGCTTTGGATCCCGAGTACAGCGAAGCGGATTCTAGTAAAGGCTTGATTGAATTGGTTCTCGTTGAAG
CGCGGGATCTTGTGGCCGCGGATATTAGAGGAACCAGTGATCCTTATGTTAGGGTTCAATATGGAGAGAAGAAACAGAGG
ACAAAGGTGATTTATAAGACGTTGCAACCAAAATGGAACCAGACAATGGAGTTTCCAGATGATGGGAGCTCCTTGGAGCT
ACATGTGAAAGACTATAACACTCTGCTTCCGACTTCAAGCATCGGTAACTGCGTTGTGGAGTACCAAGGGTTAAAGCCAA
ATGAGACTGCCGATAAGTGGATAATTCTCCAAGGAGTGAAACACGGGGAGGTCCATGTCAGAGTCACGAGGAAAGTCACG
GAGATTCAGAGACGCGCCAGCGCAGGTCCTGGCACACCGTTTAACAAAGCTCTGTTACTGTCCAACCAGATGAAGCAGGT
GATGATAAAGTTTCAGAATTTGATTGACGATGGAGATCTTGAAGGTCTTGCTGAAGCTTTAGAAGAGCTGGAAAGTTTGG
AGGACGAACAAGAACAGTATTTGCTCCAGCTTCAGACAGAGCAATCGCTGCTTATCAACAAGATCAAAGACCTTGGTAAG
GAGATTCTTAACTCATCCCCAGCTCAAGCCCCGTCTCGAGATTCTTAA