Details for Arabidopsis Locus AT3G18350

Position : Chr3 ( 5`- 6296850 .. 6300673 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18350

Protein [Map View]
MSSKTRNMLEGLVRDTSFKWLLGKQSSFDEEIEEMGRSPSAGTNWIPELSPIANVVVRRCSKILGVSANELRDSFKQEAF
ESLKQPSLFPRNFLEYCCFRALSLSVGVTGHLADKKFRRLTFDMMVVWEVPAVASQALLSVEEDATVSLEAFSRIAPAVP
IIADVIICDNLFQMLTSSTGGRLQFSVYDKYLHGLERAIKKMRTQSESSLLSGVRSKREKILEIDGTVTTQPVLEHVGIS
TWPGRLILTDHSLYFEALKVVSYDTPKRYHLSEDLKQIIKPELTGPWGTRLFDKAVSYQSISLSEPVVMEFPELKGHTRR
DYWLTIIQEVLYVHRYINKYKITGLARDEALSKAVLGVMRVQALQELNLTNAMRYENLLPFNLCDQLPGGDLILETLAEM
STSRELHRSNKSKDTGTLHSSASDMVSQLGSVFGGSSPRSRRETSSLVVGEVVVGDVNPLERAVKESRKKYEKVVLAQET
INGVKMGGIDTNLAVMKELMLPIMETWNLILSVVYWDDPTKSSVFCLLTTFIIWRGWLVYVFALASLFSAIFMVLTRCFS
REKLMIELKVTAPPPMNTMEQLLAVQNGISELEQNIQDANIVLLKFRALLFSLFPQASQKFAIAIVVAATMMAFVPGRYL
LSVVFVELFTRYSPPRRASTERLIRRLREWWFSIPAAPVVLLHDKNNKKKKN*

DNA
ATGTCGAGCAAAACCCGGAATATGCTTGAAGGTTTGGTTAGAGATACTTCTTTTAAATGGTTGCTCGGGAAACAAAGTTC
TTTCGATGAAGAAATCGAGGAAATGGGAAGATCTCCATCAGCTGGGACTAATTGGATACCTGAGCTTTCTCCTATTGCCA
ATGTGGTTGTCCGCAGGTGTTCAAAAATACTCGGTGTTTCTGCAAACGAGCTACGAGATAGTTTCAAACAAGAGGCATTT
GAATCTCTCAAGCAGCCTTCTCTATTTCCAAGGAACTTTCTAGAGTACTGTTGTTTCAGAGCACTTTCACTGTCTGTTGG
AGTAACAGGTCATCTAGCCGATAAAAAGTTTCGGCGCTTAACATTTGACATGATGGTTGTCTGGGAAGTCCCAGCTGTTG
CTAGCCAGGCTTTACTCAGTGTAGAAGAAGATGCAACAGTGAGTTTAGAAGCCTTCTCACGGATCGCACCAGCAGTTCCA
ATAATAGCTGATGTGATTATATGTGATAATCTGTTTCAAATGCTTACTTCATCAACGGGTGGTCGGCTTCAGTTCTCTGT
TTATGACAAGTATTTACATGGCCTGGAGAGAGCAATAAAGAAGATGAGGACTCAGTCCGAATCATCTTTGCTTTCTGGTG
TTCGATCAAAAAGAGAAAAGATTCTGGAAATAGACGGGACAGTTACTACCCAACCAGTTCTTGAACATGTCGGAATATCA
ACGTGGCCAGGTCGCTTAATCCTGACAGACCATTCCCTATATTTTGAGGCCTTAAAGGTCGTGTCTTATGACACACCAAA
GCGATATCACCTATCTGAAGATCTAAAGCAAATAATTAAACCTGAGTTAACTGGTCCTTGGGGCACTCGGCTTTTCGACA
AGGCCGTTTCTTACCAGTCTATATCTCTATCAGAACCAGTGGTAATGGAATTCCCAGAGCTTAAAGGCCACACACGCCGT
GATTACTGGCTCACTATTATACAAGAGGTATTATATGTTCATAGATACATAAACAAGTACAAGATCACCGGTTTGGCAAG
AGACGAAGCACTTTCAAAGGCTGTCCTTGGCGTTATGCGTGTCCAAGCTCTTCAAGAACTCAATTTGACAAACGCAATGC
GGTACGAAAATCTTCTCCCGTTCAATCTCTGCGATCAGCTTCCCGGTGGAGATCTGATTCTTGAGACGCTTGCAGAGATG
TCTACCTCAAGAGAGCTCCATCGATCAAATAAATCCAAAGATACAGGGACATTACATTCCTCAGCTTCTGATATGGTTTC
GCAGCTGGGTTCTGTGTTTGGAGGGTCAAGTCCTAGGAGCAGGAGGGAGACGAGTAGTCTTGTGGTAGGTGAAGTAGTGG
TTGGAGATGTGAATCCATTAGAGAGAGCAGTGAAGGAGTCGCGCAAGAAATACGAGAAAGTAGTTCTAGCGCAAGAGACG
ATTAATGGGGTGAAAATGGGTGGCATTGACACCAACTTAGCCGTGATGAAGGAACTGATGCTTCCAATAATGGAAACCTG
GAACTTAATTCTATCTGTGGTGTATTGGGATGATCCTACAAAGTCTAGTGTTTTCTGTCTCTTGACCACTTTCATAATTT
GGAGGGGATGGCTTGTTTATGTCTTTGCTCTTGCGTCTCTCTTCTCTGCCATCTTCATGGTTCTCACAAGATGTTTCAGC
AGAGAAAAGCTCATGATCGAGCTGAAAGTAACTGCTCCTCCTCCAATGAACACAATGGAACAGCTTTTGGCAGTCCAGAA
CGGGATCTCGGAGCTCGAACAGAACATTCAAGACGCAAACATCGTTCTTCTCAAGTTCCGAGCTTTATTATTCTCGCTTT
TCCCTCAGGCGAGCCAGAAGTTTGCGATTGCGATTGTGGTCGCAGCGACGATGATGGCCTTTGTTCCGGGACGCTACTTG
CTTTCGGTTGTATTTGTTGAGCTTTTCACAAGATACTCGCCACCAAGGAGAGCTAGCACGGAACGGTTAATAAGGCGGTT
GAGAGAGTGGTGGTTTAGTATACCAGCGGCTCCAGTGGTCCTTCTACATGACAAGAACAATAAGAAGAAGAAGAACTAA