Details for Arabidopsis Locus AT3G18300

Position : Chr3 ( 5`- 6281923 .. 6284372 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18300

Protein [Map View]
MICTESNHQRFSFAGDLGQSDKGTPMEQQPSGPVRRDTTLLDSSNSDFEFHISSNFDPGDSSPADEIFADGMILPVLPFQ
VTATSTMPKRLYKYELPPIVSAPTLSSYLPPLPLPLPEHSRKYSVKETRGSLNGRGSGANSDSEAEKSSKSFWSFKRSSS
LNCDIKKSLICSFPRLTRSNSTGSVAISKREMLRDINKHSSQRHGVPRPGVNPSSHMRPPSSFCCSSYQFRPQKHAGKNG
GGRGGSFWIAPVIGGPSPFGLGSILRLTKEKKKK*

DNA
ATGATCTGCACGGAGTCAAACCACCAGCGGTTTTCGTTTGCTGGTGATCTCGGCCAGTCCGATAAAGGAACTCCTATGGA
ACAACAACCATCAGGCCCGGTCCGAAGAGACACCACTCTTTTGGATTCATCAAACTCAGATTTCGAGTTCCACATCTCAA
GCAACTTTGATCCTGGAGATTCCTCACCAGCTGACGAGATATTTGCGGACGGCATGATCCTCCCAGTTCTTCCTTTCCAA
GTCACAGCTACATCCACCATGCCAAAACGTCTCTACAAATATGAGCTCCCTCCTATTGTCTCTGCTCCAACCTTATCCTC
TTATCTTCCTCCTCTGCCTTTACCATTGCCTGAACACTCAAGAAAATACAGCGTGAAAGAAACTCGAGGAAGCCTAAATG
GACGAGGGAGCGGTGCAAATTCGGATTCAGAGGCAGAGAAATCATCAAAGTCGTTTTGGAGCTTCAAGAGAAGCTCAAGC
CTGAACTGCGATATAAAGAAGAGTCTGATCTGTTCGTTTCCTCGTTTAACGAGAAGCAATTCCACAGGATCAGTGGCGAT
TTCGAAGAGGGAAATGCTTAGGGACATTAACAAGCATAGCTCGCAGAGACATGGAGTCCCACGTCCAGGGGTGAATCCAT
CATCTCATATGCGTCCTCCTTCCTCTTTCTGCTGCAGCTCGTATCAGTTCAGGCCACAAAAACACGCCGGAAAGAATGGT
GGCGGAAGAGGAGGAAGTTTTTGGATTGCTCCGGTGATCGGTGGTCCATCTCCGTTTGGGTTAGGATCCATCTTACGACT
TACGAAAGAGAAAAAAAAGAAGTAA