Details for Arabidopsis Locus AT3G18295

Position : Chr3 ( 5`- 6281204 .. 6282306 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18295

Protein [Map View]
MELPPPPERSKRLHNFTLPYLRWGQQRFLRCVKLPHHNRSPSFPSSSSSPSPDHRSHNGGLSGELRLDLVYDANRPKLSV
LGNGGDNNNGDVVAAARPWNLRTRRAACNEPPGDDSTRIIESSSSLRRHEIGVKRGGSEDGGDSQQNKNEKVKFSVSLLR
EEIEQDFSALIGKRPPRRPKKRPRLVQKQMNTLFPGLWLAEEVTADSYDVPEAVET*

DNA
ATGGAGCTTCCTCCTCCACCGGAAAGATCCAAACGCCTCCATAACTTCACCTTACCTTATCTCCGATGGGGTCAGCAAAG
ATTCCTCCGCTGCGTCAAGCTTCCTCACCACAACCGATCTCCTTCTTTTCCTTCTTCTTCTTCTTCTCCTTCTCCCGATC
ATAGATCTCACAACGGAGGACTTTCAGGTGAGCTCAGGCTCGATCTCGTCTACGATGCCAACAGACCTAAGCTCTCCGTT
TTGGGCAATGGAGGTGACAACAACAACGGCGATGTTGTTGCAGCTGCTCGGCCGTGGAATTTGAGAACGAGAAGAGCTGC
TTGTAACGAACCACCTGGTGATGATTCCACCAGGATCATCGAGTCTTCTTCTTCTCTACGGAGACATGAAATTGGCGTTA
AGAGAGGTGGTAGCGAAGATGGAGGAGATTCGCAGCAGAATAAGAATGAGAAAGTGAAATTCTCTGTTTCTTTGTTGAGA
GAAGAAATCGAACAAGATTTCTCTGCCTTAATTGGTAAAAGACCTCCGAGACGACCGAAGAAGAGACCCAGATTGGTTCA
GAAGCAAATGAATACTCTATTTCCAGGATTGTGGTTAGCAGAAGAAGTAACAGCAGACTCTTACGATGTTCCTGAGGCTG
TGGAAACATGA