Details for Arabidopsis Locus AT3G18280

Position : Chr3 ( 5`- 6267049 .. 6267643 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18280

Protein [Map View]
MVMIKTTMVSLFALAAVLLMILAPAAEAVTCSPMQLSPCATAITSSSPPSALCCAKLKEQRPCLCGYMRNPSLRRFVSTP
NARKVSKSCKLPIPRC*

DNA
ATGGTGATGATCAAGACCACAATGGTTTCCCTTTTTGCTCTAGCGGCGGTTCTCCTAATGATTCTAGCCCCGGCGGCAGA
AGCCGTGACGTGCTCGCCAATGCAGCTAAGCCCATGTGCAACGGCGATAACGTCGTCTTCTCCACCATCGGCTTTGTGCT
GTGCAAAGCTGAAGGAGCAGAGGCCATGCTTATGTGGTTACATGAGAAACCCTAGCCTCCGTCGCTTCGTCAGCACTCCC
AACGCTCGTAAAGTCTCTAAAAGTTGCAAACTCCCCATCCCAAGGTGTTAA