Details for Arabidopsis Locus AT3G18270

Position : Chr3 ( 5`- 6261905 .. 6264309 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18270

Protein [Map View]
MFSILSSSSSSQLVNSTLNFQNSPKSPITVMSKTSKFKTLTENFTVRVLKAENRELNVALLSPFTIASSRLDSVSNVAIR
IELNDGFVGWGEAPILPSVTAEDQIMAMVKAREASEFLRELPEMKLGNVLQEIGRFLPGHQFASVRAGMEMAMIDAAAKS
VRVPLWKLFGGASSTITTDITIPIVSPAEASVLASKYRKRGFETLKLKVGKNLKADIEVLQAIRAVHPTCSFILDANEGY
QTEEAVKVLETLHEMKVTPVLFEQPVHRDNWEGLSHVTRTAKNRFGVSIAADESCRGLTDLKKIIEGNIVDVVNIKLAKT
GILESLEVIELARSSGIELMIGGMVETRLAMGFSGHLAAGLGCFRFIDLDTPLLLADDPVQGGYKACGAVYEFKDEGGHG
GYLQWNDVAQ*

DNA
ATGTTTTCGATTTTATCATCATCTTCTTCTTCACAACTCGTCAATTCAACTCTCAATTTCCAAAATTCGCCGAAATCTCC
GATCACCGTTATGTCGAAGACGTCTAAATTCAAAACCCTGACGGAGAATTTCACCGTGAGAGTGCTTAAAGCAGAGAATC
GCGAACTGAACGTGGCTCTGCTCTCACCTTTCACTATCGCTTCTTCACGGCTTGATTCTGTCAGTAATGTTGCGATTCGG
ATTGAGCTCAACGATGGATTTGTGGGTTGGGGAGAAGCTCCGATTTTGCCGTCGGTAACGGCGGAGGATCAGATAATGGC
TATGGTAAAAGCGCGGGAAGCTAGTGAGTTTCTGAGAGAGTTACCGGAGATGAAACTCGGTAATGTTCTTCAGGAGATCG
GAAGATTTCTTCCTGGTCATCAGTTTGCTTCTGTAAGAGCTGGGATGGAGATGGCTATGATTGATGCAGCTGCTAAGAGT
GTAAGAGTGCCATTGTGGAAACTATTTGGTGGAGCTTCAAGTACGATTACTACAGACATAACAATTCCGATAGTTTCTCC
GGCTGAAGCTTCCGTATTGGCCTCAAAGTATAGAAAACGAGGTTTTGAAACCTTGAAGCTCAAGGTGGGAAAGAATCTTA
AGGCTGACATAGAAGTTCTCCAGGCTATACGTGCAGTCCACCCTACTTGTTCCTTCATTTTGGATGCCAATGAGGGTTAT
CAAACAGAGGAAGCTGTTAAAGTTCTCGAGACGCTGCATGAAATGAAGGTTACACCGGTTCTCTTTGAACAACCTGTCCA
CAGAGACAATTGGGAGGGTCTCAGTCACGTGACTCGAACTGCAAAGAACAGATTCGGAGTCTCTATTGCAGCAGATGAGA
GTTGCAGAGGCTTGACTGATCTCAAAAAAATCATAGAAGGTAATATCGTAGATGTTGTGAACATCAAACTCGCCAAAACC
GGAATCCTCGAGTCTCTTGAGGTAATTGAATTGGCTAGATCATCTGGCATTGAGCTTATGATAGGGGGAATGGTGGAGAC
TAGATTAGCAATGGGGTTCTCTGGTCACCTTGCTGCTGGCCTTGGATGCTTCAGATTCATCGACTTGGACACTCCGCTTC
TTCTGGCTGATGATCCAGTTCAAGGTGGCTACAAAGCATGTGGTGCTGTCTATGAGTTTAAAGATGAAGGCGGTCACGGA
GGATATCTTCAGTGGAATGATGTTGCTCAGTGA