Details for Arabidopsis Locus AT3G18240

Position : Chr3 ( 5`- 6255742 .. 6258090 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18240

Protein [Map View]
MRGALLRNASLCARRIILSPRITHQISPNVPFLAPIAAPAAPKFRFFSSESGENSTTAPESSPTDSPEKKDLVVEDVSNK
ELKSRIEKYFNEGNEDALPGVIEALLQRRLVDKHAETDDELLEKIESLPFKDDVKDEDFESDFEEAHSTDEELEDLYNSP
EYVAEKMRKNEFFNMDDKKWDHMIREGIQHGCLTDTKECEEILEDMLKWDQLLPDDLKKKVEAKFNELGDMCERGEIEAE
AAYELFKEFEDEMVIQYGDQMEAEGPPQFGETDASDRNTDLDDPPGKGPILRWQSRIVFAPGGDAWHPKNRKVKMSVTVK
ELGLSKHQAKRLRELVGKRYHSGKDELTITSERFEHREENRKDCLRTLYGLIEEAGKANKIAEDIRTSYVKQRLRANPAF
MQKLQAKIIRSKESDAINA*

DNA
ATGAGAGGAGCTCTCTTGAGAAATGCATCTCTCTGCGCTCGCAGAATCATTCTTTCTCCTCGTATAACCCATCAGATCTC
CCCCAATGTTCCCTTTCTCGCTCCAATCGCCGCTCCTGCTGCTCCCAAGTTCAGATTTTTCTCCTCCGAATCCGGTGAGA
ACTCGACTACGGCCCCTGAGTCTTCGCCGACTGATTCACCCGAGAAGAAAGATCTCGTTGTAGAAGATGTAAGCAACAAA
GAGCTTAAAAGCCGTATAGAGAAGTATTTCAATGAGGGTAATGAAGATGCTTTACCCGGAGTTATTGAAGCACTTCTACA
GAGAAGACTTGTAGACAAACACGCAGAGACTGATGATGAATTGTTGGAAAAAATCGAGTCTCTACCTTTCAAAGATGATG
TCAAGGATGAAGATTTTGAATCCGATTTCGAGGAAGCACATTCTACTGACGAAGAACTTGAGGATTTGTACAATTCTCCC
GAGTATGTAGCTGAAAAGATGAGGAAGAATGAGTTTTTCAACATGGATGATAAGAAGTGGGATCACATGATTAGAGAAGG
TATCCAACATGGGTGTCTTACTGATACTAAAGAATGCGAGGAGATTCTTGAGGATATGCTCAAATGGGACCAGCTTCTTC
CTGATGACTTGAAGAAAAAGGTTGAAGCAAAGTTTAATGAGCTTGGAGATATGTGTGAAAGAGGTGAAATTGAGGCTGAA
GCAGCTTATGAGCTTTTTAAGGAATTTGAAGATGAGATGGTAATTCAGTATGGGGATCAGATGGAAGCTGAGGGTCCTCC
CCAATTTGGTGAAACAGATGCTTCCGATAGGAATACTGACTTGGATGATCCCCCTGGTAAAGGCCCAATCCTCAGGTGGC
AATCAAGGATAGTTTTTGCTCCTGGAGGTGATGCGTGGCATCCAAAGAACAGGAAAGTTAAAATGTCTGTTACAGTGAAA
GAGCTTGGGCTCTCAAAGCATCAGGCTAAAAGGCTAAGGGAACTTGTAGGGAAAAGATACCATTCGGGGAAAGACGAGCT
TACAATCACCAGCGAGAGGTTTGAACACCGAGAGGAAAACAGGAAAGACTGCTTAAGAACTCTTTACGGGTTGATAGAAG
AAGCTGGGAAAGCCAACAAGATCGCTGAAGACATAAGAACTTCATATGTAAAACAAAGACTCCGTGCCAATCCAGCTTTT
ATGCAGAAACTACAAGCCAAGATCATAAGGTCTAAAGAATCAGATGCCATCAACGCTTGA