Details for Arabidopsis Locus AT3G18220

Position : Chr3 ( 5`- 6247914 .. 6249960 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18220

Protein [Map View]
MAKIMLGSHSVKSHGWKVAREHLCDWLILVVLGLIDIVLNVIEPFHRYIGPDMLTDLTFPFYEDTIPMWAVPIICILVPI
CIFIVYYYYRRDVYDLHHAILGIGFSCLVTGVTTDSIKDAVGRPRPNFFYRCFPNGKPKFHPDTKDVVCHGVKKIIKEGY
KSFPSGHTSWSFAGLTFLAWYLSGKIKVFDRRGHVAKLCLVFLPILISILIGISRVDDYWHHWTDVFAGAIIGIFVASFS
YLHFFPYPYDENGWAPHAYFRMLAERSTGRATTMTRTGSRGMLGNDVEPGNSASSPHDRHRESTDSDF*

DNA
ATGGCTAAGATAATGCTTGGATCTCACTCGGTTAAGAGCCATGGATGGAAGGTGGCTCGTGAACATCTTTGTGACTGGCT
CATCCTCGTAGTCCTCGGTCTCATCGACATTGTACTCAATGTTATCGAGCCTTTTCATCGCTATATTGGACCTGACATGT
TAACCGATCTCACTTTCCCATTTTATGAAGACACCATCCCTATGTGGGCTGTCCCGATTATTTGTATATTGGTTCCGATA
TGCATCTTCATAGTGTACTATTACTATCGAAGAGATGTTTATGATCTTCATCACGCCATTCTCGGTATCGGATTCTCATG
TCTTGTGACTGGAGTCACCACTGATTCCATCAAAGACGCGGTCGGTAGGCCACGCCCTAACTTCTTTTACCGATGTTTTC
CCAATGGTAAACCGAAATTTCATCCGGATACTAAGGATGTTGTGTGTCATGGAGTTAAAAAGATAATCAAAGAAGGTTAC
AAGAGTTTCCCTAGTGGTCACACTTCATGGTCATTCGCTGGTTTAACTTTCCTAGCGTGGTACTTATCGGGTAAAATCAA
AGTCTTTGACAGAAGAGGTCACGTGGCGAAGCTATGCCTCGTGTTCTTACCGATACTCATATCAATTCTCATCGGAATAT
CACGCGTAGACGACTATTGGCACCATTGGACCGATGTCTTCGCCGGAGCTATCATCGGAATTTTTGTCGCTTCTTTCTCT
TACCTCCACTTTTTTCCTTACCCTTACGACGAAAACGGATGGGCTCCACATGCGTATTTTAGAATGTTGGCGGAGAGGAG
CACTGGTCGAGCCACGACGATGACTCGAACCGGTTCTCGAGGAATGTTGGGCAACGACGTTGAGCCTGGCAACTCCGCGT
CCTCGCCGCACGATCGCCACCGTGAAAGCACTGATTCTGACTTTTGA