Details for Arabidopsis Locus AT3G18215

Position : Chr3 ( 5`- 6240850 .. 6242573 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18215

Protein [Map View]
MWTEESLDLVLVPTGLVVMVAYHVWLVYAILHRPKLTVIALNAESRRQWVFSMMTEPLKNGTLAVQTIRNNIMASTLLAT
TAITLCSIIGVFVSNSSSSKSTATNLIYGSKSPRLASFKNFAILICFLMAFLCNIQSIRYYAHVSFLVTVPVSRGKREHC
EYVSRNLNRASYFWSLGLRAFYFSFPLFLWTFGPIPMFVCCCMMSSILYFLDTTTSFTRHLHSQSFRETADSMDGEIESA
VHTL*

DNA
ATGTGGACGGAGGAATCTTTGGATTTAGTGCTTGTGCCGACGGGTCTGGTCGTGATGGTTGCTTACCATGTCTGGCTCGT
CTACGCTATTCTTCACCGCCCCAAGCTCACTGTTATCGCTCTCAACGCTGAGTCTCGACGACAATGGGTCTTCTCTATGA
TGACTGAACCACTGAAAAATGGTACCTTGGCTGTTCAGACAATCCGGAACAACATAATGGCATCAACCCTTTTAGCCACA
ACAGCAATCACTTTATGTTCCATCATCGGCGTCTTTGTAAGCAACTCGTCATCTTCAAAATCCACGGCAACAAATCTCAT
ATACGGGAGCAAAAGCCCTCGCTTAGCGTCATTCAAGAACTTTGCAATCCTGATCTGTTTCCTCATGGCCTTTCTCTGCA
ACATCCAGTCAATCAGGTATTACGCTCACGTAAGTTTCCTAGTCACAGTGCCTGTCTCAAGAGGGAAAAGAGAGCACTGC
GAGTACGTGTCTAGAAACCTGAACCGAGCTAGCTACTTCTGGTCTCTCGGATTACGGGCTTTCTACTTCTCCTTCCCTCT
CTTCTTATGGACCTTCGGGCCAATCCCGATGTTTGTGTGCTGTTGTATGATGTCCTCGATTCTATATTTCTTGGACACGA
CCACTAGTTTTACCAGGCATCTTCATAGCCAATCGTTCAGAGAAACGGCTGATTCAATGGACGGCGAAATCGAATCAGCT
GTTCATACTCTGTAG