Details for Arabidopsis Locus AT3G18210

Position : Chr3 ( 5`- 6237930 .. 6240605 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18210

Protein [Map View]
MSSEQREGSQETTTTTVEGNGTIAGQNSHSAAPTTLRATSTMVSCQRLRLNPNNEHRPDSYEDLQLDFPNSVYSSLEKYL
PPNMLVSNRDEKIKFMTDIMLRHLPHGERSRAQRHSDYRLKITTNYQPLHKELYTLVPTVCFVPAFLKAINENTEESFRN
IISEPSPGVFVFDMLQPSFCEMMLAEIDNFERWVGETKFRIMRPNTMNKYGAVLDDFGLDTMLDKLMEGFIRPISKVFFS
DVGGATLDSHHGFVVEYGKDRDVDLGFHVDDSEVTLNVCLGNQFVGGELFFRGTRCEKHVNTATKADETYDYCHIPGQAV
LHRGRHRHGARATTCGHRVNMLLWCRSSVFRELKTHHKDFSSWCGECFCEKRDEKVRSIDALRKKLFKPRQTQA*

DNA
ATGTCAAGTGAGCAGCGAGAAGGTTCGCAAGAGACGACGACGACGACGGTGGAAGGTAACGGAACAATTGCAGGTCAGAA
TTCTCATTCGGCGGCTCCCACGACATTGAGAGCTACCTCTACGATGGTTTCTTGCCAGAGACTAAGGCTAAACCCTAACA
ACGAGCATAGACCCGATAGTTATGAAGATCTGCAGCTTGATTTCCCAAACTCGGTATATTCTAGTCTGGAGAAGTACTTG
CCTCCGAATATGCTCGTCTCGAATCGTGATGAGAAAATCAAATTCATGACTGATATTATGCTTAGGCATCTTCCTCATGG
AGAGCGTTCCAGAGCTCAAAGGCACAGTGACTATAGGCTGAAGATTACAACAAATTATCAGCCACTTCACAAGGAGTTGT
ATACTCTAGTTCCCACAGTATGTTTCGTTCCTGCTTTCCTTAAGGCGATAAATGAAAACACAGAGGAAAGCTTCAGAAAT
ATAATATCTGAACCGTCTCCTGGTGTTTTCGTCTTTGACATGCTCCAGCCTAGCTTTTGTGAGATGATGCTAGCCGAGAT
AGACAATTTTGAAAGGTGGGTGGGTGAGACCAAATTCCGGATAATGAGACCAAACACCATGAATAAATACGGTGCTGTGC
TTGACGACTTTGGTCTAGACACCATGCTTGACAAACTCATGGAGGGGTTTATACGTCCCATCTCTAAAGTATTCTTCAGT
GATGTGGGTGGAGCAACTCTGGACTCTCACCATGGTTTTGTTGTTGAATATGGGAAAGATAGGGATGTTGATTTAGGCTT
TCATGTGGATGATTCAGAAGTAACGCTGAATGTTTGTTTGGGTAATCAATTTGTGGGAGGGGAGCTATTTTTCAGAGGCA
CACGGTGTGAAAAACATGTGAACACAGCAACAAAGGCAGATGAAACATATGATTATTGTCATATACCTGGACAAGCTGTG
CTTCACCGTGGCCGCCACCGCCATGGTGCCAGAGCCACAACATGCGGGCATCGGGTCAATATGCTTCTATGGTGCAGAAG
TTCTGTATTTAGAGAGCTCAAAACTCATCACAAGGATTTCTCCAGCTGGTGTGGAGAGTGCTTTTGTGAAAAGAGAGATG
AGAAAGTGCGGTCGATTGATGCTCTAAGAAAGAAATTGTTTAAACCACGTCAAACCCAAGCTTGA