Details for Arabidopsis Locus AT3G18165

Position : Chr3 ( 5`- 6223188 .. 6225372 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18165

Protein [Map View]
MATNNGDVLMLEATPEAARPWASAANAEVIDALPYIDDDYGNPLIKSEVDRLVEEEMRRSSKKPADFLKDLPPLPKFDFK
NCPVLGKEYERVRAGKPPVRIDFESRYKLEMPPANKRNDDAAWKQYLQKNQRSLQQKLIELENLELMSKLGPELWRQNNH
RLEVFLTRMQRLAQEQNEEIEKVNRERKYHQQTTSYELNALSQEWRQLCVKNMEIQSACAMLETQIDSFKKEAAERGWNL
EEKLENVEPLQMQ*

DNA
ATGGCGACGAACAATGGTGATGTCTTGATGTTGGAGGCGACGCCGGAGGCTGCGAGGCCCTGGGCTAGTGCGGCGAATGC
AGAAGTTATCGATGCGCTTCCTTATATAGACGACGACTATGGCAATCCATTGATTAAGTCGGAGGTAGACCGTTTGGTGG
AGGAAGAGATGCGTCGGAGCTCTAAGAAGCCAGCTGACTTTCTAAAGGACTTGCCTCCTCTTCCGAAGTTCGATTTTAAG
AACTGCCCTGTTCTTGGCAAAGAGTATGAGCGTGTTAGAGCTGGGAAGCCTCCTGTGCGGATAGATTTCGAATCCCGATA
CAAACTTGAAATGCCACCTGCCAATAAGAGGAATGATGATGCTGCCTGGAAGCAGTATCTTCAGAAGAATCAACGGTCAT
TGCAACAGAAGCTGATTGAGCTTGAGAATTTGGAATTGATGTCAAAACTTGGCCCCGAGCTTTGGAGACAGAACAACCAT
CGCCTTGAAGTATTTTTGACCAGAATGCAAAGACTAGCACAGGAGCAGAATGAGGAAATTGAAAAAGTAAATCGGGAAAG
GAAGTATCATCAGCAAACCACATCATACGAGCTCAATGCTCTATCTCAAGAATGGAGACAGCTCTGTGTTAAGAATATGG
AGATTCAGTCTGCTTGTGCCATGCTTGAGACACAGATCGATTCGTTCAAGAAAGAAGCTGCTGAAAGGGGTTGGAACTTA
GAAGAGAAACTAGAGAACGTCGAGCCACTTCAAATGCAATGA