Details for Arabidopsis Locus AT3G18140

Position : Chr3 ( 5`- 6212596 .. 6214785 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18140

Protein [Map View]
MSQPSVILATASYDHTIRFWEAETGRCYRTIQYPDSHVNRLEITPDKHYLAAACNPHIRLFDVNSNSPQPVMTYDSHTNN
VMAVGFQCDAKWMYSGSEDGTVKIWDLRAPGCQKEYESVAAVNTVVLHPNQTELISGDQNGNIRVWDLRANSCSCELVPE
VDTAVRSLTVMWDGTMVVAANNRGTCYVWRLLRGKQTMTEFEPLHKLQAHNGHILKCLLSPANKYLATASSDKTVKIWNV
DGFKLEKVLTGHQRWVWDCVFSVDGEFLVTASSDMTARLWSMPAGKEVKVYQGHHKATVCCALHD*

DNA
ATGAGTCAGCCTTCTGTGATTCTTGCTACGGCTAGCTATGATCACACCATCCGATTCTGGGAAGCCGAAACTGGTCGCTG
TTACCGTACCATTCAGTATCCTGATTCGCATGTAAATAGGCTTGAGATAACCCCAGATAAGCATTATCTAGCTGCAGCTT
GCAATCCTCATATTCGACTCTTTGATGTCAATTCCAATAGTCCTCAACCTGTGATGACTTACGATTCACACACCAACAAT
GTTATGGCAGTAGGATTTCAATGTGATGCAAAATGGATGTATTCAGGATCAGAAGATGGCACAGTTAAGATCTGGGACTT
AAGGGCTCCGGGTTGCCAAAAGGAGTATGAAAGTGTTGCAGCGGTTAATACAGTTGTTTTACACCCAAATCAGACTGAAT
TGATATCTGGAGACCAAAATGGAAATATACGTGTATGGGATCTCAGAGCAAATTCGTGTAGCTGTGAACTGGTACCAGAA
GTTGATACAGCTGTACGGTCTTTAACTGTTATGTGGGATGGGACAATGGTAGTCGCTGCTAACAACCGTGGAACATGTTA
TGTATGGCGCTTGTTGCGTGGAAAACAGACAATGACAGAGTTTGAGCCCCTTCATAAGCTGCAAGCTCATAATGGCCACA
TCCTTAAATGTCTCCTCTCTCCTGCAAACAAATATCTAGCGACTGCATCATCTGATAAAACTGTCAAAATATGGAACGTC
GATGGTTTTAAACTAGAGAAAGTTTTAACAGGACATCAAAGATGGGTTTGGGACTGCGTCTTCTCAGTGGATGGAGAATT
TCTTGTAACAGCATCATCGGACATGACGGCTAGATTGTGGTCGATGCCAGCAGGCAAAGAAGTGAAAGTGTACCAAGGTC
ATCACAAAGCCACTGTGTGCTGTGCACTTCACGATTAA