Details for Arabidopsis Locus AT3G18130

Position : Chr3 ( 5`- 6210904 .. 6212433 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18130

Protein [Map View]
MAEGLVLKGIMRAHTDIVTAIATPIDNSDIIVTASRDKSIILWKLTKDDKSYGVAQRRLTGHSHFVEDVVLSSDGQFALS
GSWDGELRLWDLATGETTRRFVGHTKDVLSVAFSTDNRQIVSASRDRTIKLWNTLGECKYTISEGDGHKEWVSCVRFSPN
TLVPTIVSASWDKTVKVWNLQNCKLRNSLVGHSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHSL
CFSPNRYWLCAATENSIRIWDLESKSVVEDLKVDLKSEAEKNEGGVGTGNQKKVIYCTSLNWSADGSTLFSGYTDGVVRV
WGIGRY*

DNA
ATGGCCGAGGGACTCGTATTGAAGGGCATTATGCGCGCCCACACCGACATTGTCACGGCCATCGCTACGCCGATCGACAA
TTCCGACATCATCGTCACAGCGTCGCGTGACAAATCCATCATCCTCTGGAAACTCACAAAGGACGATAAGTCTTACGGTG
TTGCTCAGCGTAGGCTCACAGGTCACTCTCACTTCGTGGAAGATGTTGTTCTCTCATCGGACGGTCAGTTTGCACTCTCC
GGAAGCTGGGACGGTGAGCTCCGTCTCTGGGATCTTGCCACGGGAGAAACAACTCGTCGATTCGTTGGTCATACGAAAGA
TGTGCTCTCTGTTGCATTCTCTACTGATAACCGGCAGATCGTGTCTGCTTCTCGTGATCGTACGATTAAGCTTTGGAACA
CACTTGGTGAGTGTAAGTATACCATCTCTGAAGGTGATGGTCACAAGGAATGGGTTAGTTGTGTTAGGTTTAGTCCTAAT
ACTCTTGTACCAACTATTGTATCTGCTTCTTGGGATAAAACTGTGAAAGTTTGGAATCTCCAGAACTGTAAGCTGAGGAA
CTCTCTTGTTGGTCACTCTGGTTACCTCAACACTGTTGCTGTCTCGCCTGATGGTTCGCTATGCGCCAGTGGTGGGAAAG
ATGGTGTTATCTTGTTGTGGGATTTGGCTGAAGGAAAGAAGCTTTACTCGCTTGAGGCGGGTTCGATTATTCACTCGCTT
TGCTTCAGTCCTAACAGATACTGGTTGTGTGCTGCTACTGAGAATAGCATTAGGATTTGGGATCTTGAGAGCAAGTCTGT
TGTTGAGGACTTGAAGGTTGATCTCAAGTCTGAGGCAGAGAAGAATGAAGGTGGTGTTGGAACTGGTAACCAGAAGAAGG
TTATCTACTGCACAAGCTTGAACTGGAGTGCAGATGGAAGCACATTGTTCAGTGGTTACACTGATGGAGTTGTCAGGGTC
TGGGGTATTGGTCGTTACTAG