Details for Arabidopsis Locus AT3G18110

Position : Chr3 ( 5`- 6204842 .. 6209691 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18110

Protein [Map View]
MAVSAGALAFPALSVRATLNPEIKDEQANISSTTSSSQKFTYSRASPAVRWPHLNLREIYDSTPSQTLSSPVSPIAGTPD
SGDVVDSIASREEQKTKDETAVATRRRRVKKMNKVALIKAKDWRERVKFLTDKILSLKSNQFVADILDARLVQMTPTDYC
FVVKSVGQESWQRALEVFEWLNLRHWHSPNARMVAAILGVLGRWNQESLAVEIFTRAEPTVGDRVQVYNAMMGVYSRSGK
FSKAQELVDAMRQRGCVPDLISFNTLINARLKSGGLTPNLAVELLDMVRNSGLRPDAITYNTLLSACSRDSNLDGAVKVF
EDMEAHRCQPDLWTYNAMISVYGRCGLAAEAERLFMELELKGFFPDAVTYNSLLYAFARERNTEKVKEVYQQMQKMGFGK
DEMTYNTIIHMYGKQGQLDLALQLYKDMKGLSGRNPDAITYTVLIDSLGKANRTVEAAALMSEMLDVGIKPTLQTYSALI
CGYAKAGKREEAEDTFSCMLRSGTKPDNLAYSVMLDVLLRGNETRKAWGLYRDMISDGHTPSYTLYELMILGLMKENRSD
DIQKTIRDMEELCGMNPLEISSVLVKGECFDLAARQLKVAITNGYELENDTLLSILGSYSSSGRHSEAFELLEFLKEHAS
GSKRLITEALIVLHCKVNNLSAALDEYFADPCVHGWCFGSSTMYETLLHCCVANEHYAEASQVFSDLRLSGCEASESVCK
SMVVVYCKLGFPETAHQVVNQAETKGFHFACSPMYTDIIEAYGKQKLWQKAESVVGNLRQSGRTPDLKTWNSLMSAYAQC
GCYERARAIFNTMMRDGPSPTVESINILLHALCVDGRLEELYVVVEELQDMGFKISKSSILLMLDAFARAGNIFEVKKIY
SSMKAAGYLPTIRLYRMMIELLCKGKRVRDAEIMVSEMEEANFKVELAIWNSMLKMYTAIEDYKKTVQVYQRIKETGLEP
DETTYNTLIIMYCRDRRPEEGYLLMQQMRNLGLDPKLDTYKSLISAFGKQKCLEQAEQLFEELLSKGLKLDRSFYHTMMK
ISRDSGSDSKAEKLLQMMKNAGIEPTLATMHLLMVSYSSSGNPQEAEKVLSNLKDTEVELTTLPYSSVIDAYLRSKDYNS
GIERLLEMKKEGLEPDHRIWTCFVRAASFSKEKIEVMLLLKALEDIGFDLPIRLLAGRPELLVSEVDGWFEKLKSIEDNA
ALNFVNALLNLLWAFELRATASWVFQLGIKRGIFSLDVFRVADKDWGADFRRLSGGAALVALTLWLDHMQDASLEGYPES
PKSVVLITGTAEYNGISLDKTLKACLWEMGSPFLPCKTRTGLLVAKAHSLRMWLKDSPFCFDLELKDSVSLPESNSMDLI
DGCFIRRGLVPAFNHIKERLGGFVSPKKFSRLALLPDEMRERVIKTDIEGHRQKLEKMKKKKMGNETNGINTRRKFVRSK
*

DNA
ATGGCGGTTTCTGCAGGGGCTTTAGCTTTTCCTGCTTTATCCGTTCGCGCCACTCTTAATCCTGAGATTAAAGATGAACA
AGCGAACATCAGCAGCACTACTTCTTCTTCCCAGAAATTCACTTACAGTCGAGCTTCTCCCGCCGTCCGATGGCCACATT
TGAATCTCCGTGAGATTTATGATTCCACACCTTCACAAACTCTTTCTTCTCCGGTTTCTCCCATCGCCGGTACACCGGAT
TCAGGTGATGTCGTCGATTCAATTGCCTCCCGCGAGGAGCAAAAGACGAAAGATGAAACCGCCGTGGCGACTCGGAGAAG
GAGAGTGAAGAAGATGAATAAAGTGGCGTTGATTAAGGCTAAAGACTGGAGAGAGAGAGTCAAATTTCTGACGGATAAGA
TTCTAAGCTTGAAATCTAATCAGTTCGTTGCTGATATTCTCGATGCTCGTCTTGTTCAGATGACTCCTACTGATTACTGC
TTCGTCGTGAAATCAGTTGGTCAAGAGAGTTGGCAACGAGCTCTTGAGGTTTTTGAGTGGCTCAATCTCCGTCATTGGCA
CTCTCCTAACGCTCGGATGGTGGCTGCTATACTCGGTGTTTTGGGACGGTGGAATCAGGAATCCCTTGCGGTGGAGATTT
TCACTAGGGCTGAGCCAACCGTCGGAGATAGGGTTCAGGTGTACAACGCAATGATGGGGGTTTATTCACGTAGTGGTAAG
TTTTCGAAAGCACAAGAGCTGGTCGATGCAATGCGTCAGAGAGGGTGTGTTCCAGATCTTATTAGTTTCAATACTCTTAT
CAACGCTAGGCTTAAATCTGGTGGGTTGACTCCGAATTTGGCTGTTGAGTTATTAGATATGGTGAGGAATTCGGGTCTTA
GGCCTGATGCTATCACTTACAACACTCTTCTTAGTGCCTGTTCGCGGGATTCGAATTTGGATGGTGCAGTGAAGGTTTTT
GAGGATATGGAAGCTCATCGGTGTCAGCCTGATTTGTGGACTTATAATGCTATGATTTCTGTTTATGGAAGATGTGGGCT
TGCTGCTGAAGCTGAGAGGCTCTTCATGGAGCTGGAGCTTAAAGGTTTTTTCCCTGATGCAGTGACATACAACTCTTTGC
TGTATGCGTTTGCCAGAGAAAGAAATACGGAGAAGGTGAAGGAGGTGTACCAACAGATGCAGAAAATGGGGTTTGGGAAA
GATGAGATGACATACAACACGATCATTCACATGTATGGCAAGCAGGGACAACTTGATCTTGCGCTACAGCTTTATAAGGA
CATGAAAGGTTTGTCGGGTAGGAACCCTGATGCTATTACTTACACTGTTTTGATCGATTCTCTTGGAAAAGCAAACCGAA
CAGTGGAAGCCGCAGCTTTAATGTCTGAGATGCTTGATGTTGGGATCAAACCAACTCTGCAGACATACAGTGCTCTTATC
TGTGGTTATGCCAAGGCTGGAAAGCGAGAGGAGGCTGAGGATACTTTCAGTTGCATGTTGCGCTCAGGCACTAAACCTGA
TAATTTAGCGTATTCTGTAATGTTGGATGTATTACTAAGAGGCAACGAGACAAGAAAGGCCTGGGGTTTATACCGTGATA
TGATTTCTGATGGTCATACACCGTCTTACACTCTGTATGAGTTGATGATACTTGGACTTATGAAGGAAAACAGGTCAGAT
GACATTCAGAAAACCATCAGAGACATGGAAGAATTGTGTGGCATGAACCCACTAGAGATTTCATCAGTGCTTGTTAAGGG
CGAATGCTTTGATCTCGCTGCTAGACAGTTGAAAGTGGCTATCACCAATGGCTATGAATTGGAAAACGACACTCTATTGT
CTATCCTGGGTTCCTATAGTTCATCAGGCAGGCATTCAGAAGCGTTTGAGTTACTTGAATTTTTGAAAGAGCATGCCAGT
GGATCTAAAAGACTTATAACTGAAGCTCTAATTGTTCTACATTGCAAGGTGAACAACTTAAGCGCTGCTCTAGATGAATA
TTTCGCTGACCCATGTGTTCATGGCTGGTGTTTTGGCAGTTCCACCATGTATGAGACTCTATTACACTGCTGTGTAGCAA
ATGAACATTATGCTGAAGCTTCTCAGGTTTTCTCTGACCTGAGACTATCTGGCTGCGAAGCTTCAGAAAGTGTTTGTAAA
AGCATGGTTGTTGTGTATTGCAAGCTTGGCTTTCCAGAGACAGCTCATCAAGTGGTTAATCAGGCTGAGACAAAAGGCTT
CCACTTTGCTTGTTCGCCTATGTATACTGATATCATTGAGGCTTATGGAAAACAAAAACTATGGCAGAAAGCGGAGAGTG
TGGTTGGCAACCTAAGACAAAGTGGACGAACACCTGATCTGAAGACATGGAACAGCTTGATGTCGGCTTATGCTCAGTGT
GGCTGTTACGAGCGGGCAAGGGCTATTTTTAACACTATGATGAGGGATGGTCCGTCTCCTACTGTTGAATCCATCAATAT
TTTGTTGCATGCTTTGTGTGTTGATGGGAGACTCGAGGAGCTCTACGTTGTTGTTGAAGAATTGCAAGATATGGGCTTTA
AGATTAGCAAAAGCTCCATTCTCTTGATGCTTGACGCATTTGCCCGAGCTGGAAATATCTTTGAGGTAAAGAAGATATAC
AGTAGCATGAAAGCTGCTGGTTACTTACCCACAATCCGCCTTTATAGGATGATGATTGAGCTTCTCTGCAAAGGGAAACG
AGTTAGAGATGCTGAAATTATGGTCTCTGAAATGGAAGAGGCCAATTTCAAGGTTGAGCTTGCTATATGGAATTCCATGC
TGAAGATGTATACGGCTATCGAGGATTACAAGAAGACAGTTCAAGTATACCAGAGGATAAAAGAAACTGGACTGGAACCA
GACGAGACCACTTACAATACTCTGATTATAATGTATTGTAGAGACAGACGACCAGAAGAAGGGTACTTGCTTATGCAGCA
AATGAGAAATCTTGGTTTGGACCCAAAACTGGACACATACAAGAGCTTGATCTCTGCTTTTGGTAAGCAAAAATGCCTTG
AACAAGCTGAACAACTGTTTGAAGAGCTTCTCTCAAAAGGTTTGAAACTAGACCGTTCATTTTACCACACAATGATGAAA
ATATCCCGAGATTCTGGAAGCGACTCCAAGGCAGAGAAGTTATTGCAAATGATGAAGAATGCGGGAATAGAACCAACACT
TGCTACAATGCATCTGCTTATGGTTTCATATAGTTCTTCAGGAAATCCCCAAGAAGCTGAAAAAGTTCTTAGTAACCTGA
AAGACACAGAAGTGGAACTAACAACTCTGCCTTATAGTTCAGTTATTGATGCTTACCTTCGGAGCAAAGATTATAACAGT
GGAATAGAAAGGCTTTTGGAAATGAAGAAAGAGGGCCTAGAGCCAGACCACAGGATATGGACTTGCTTTGTTAGGGCGGC
GAGTTTCTCCAAGGAAAAAATTGAAGTCATGTTGCTGCTTAAAGCTCTTGAAGATATTGGTTTTGATCTTCCTATCAGGC
TTTTAGCTGGAAGACCTGAGTTGCTAGTTTCTGAGGTGGATGGATGGTTCGAGAAACTGAAATCCATAGAGGACAATGCT
GCTCTCAATTTTGTTAATGCTCTTTTGAATCTTCTCTGGGCGTTTGAACTCAGAGCTACTGCATCATGGGTTTTCCAATT
GGGAATCAAAAGGGGTATCTTCAGTCTCGATGTTTTTAGGGTGGCGGACAAGGACTGGGGTGCGGATTTCAGAAGGCTGT
CTGGAGGTGCAGCACTTGTTGCCCTGACGCTATGGCTTGACCACATGCAGGATGCATCACTGGAAGGCTACCCAGAGTCT
CCAAAGTCAGTTGTCTTAATCACAGGGACCGCAGAGTACAACGGTATATCCCTTGATAAAACGCTAAAGGCGTGTCTTTG
GGAAATGGGTTCTCCATTTCTTCCCTGCAAGACGAGAACGGGACTGCTAGTGGCCAAAGCTCACTCTCTCAGAATGTGGT
TGAAGGACTCGCCGTTCTGCTTCGACTTGGAGCTAAAAGACTCGGTGTCTTTACCAGAATCAAACTCGATGGACCTGATT
GACGGGTGTTTCATAAGACGTGGACTTGTTCCTGCGTTTAACCACATCAAAGAGAGACTTGGTGGATTTGTGTCACCAAA
GAAGTTTTCGAGACTGGCGTTGCTACCAGACGAGATGAGAGAGCGAGTGATAAAGACAGATATTGAAGGACATAGACAGA
AGTTAGAGAAGATGAAGAAGAAGAAAATGGGCAATGAAACGAATGGTATTAACACTCGAAGGAAGTTCGTCAGAAGCAAG
TGA