Details for Arabidopsis Locus AT3G18090

Position : Chr3 ( 5`- 6194564 .. 6200237 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18090

Protein [Map View]
MACRLQNMTYSARIKVNAQVEVFKKIVIKHDKFKTGQDEYVEKEILDVKKQDILIGSIPVMVKSVLCKTSEKGKENCKKG
NCAFDQGGYFVIKGAEKVFIAQEQMCTKRLWISNSPWTVSFRSETKRNRFIVRLSENEKAEDYKIMEKVLTVYFLSTEIP
VWLLFFALGVSSDKEAMDLIAFDGDDASITNSLIASIHEADAVCEAFRCGNNALTYVEHQIKSTKFPPAESVDDCLRLYL
FPCLQGLKKKARFLGYMVKCLLSAYAGKRKCENRDSFRNKRIELAGELLEREIRVHLAHARRKMTRAMQKQLSGDGDLKP
IEHYLDASVITNGLNRAFSTGAWSHPFRKMERVSGVVANLGRANPLQTLIDLRRTRQQVLYTGKVGDARHPHPSHWGRVC
FLSTPDGENCGLVKNMSLLGLVSTQGLESVVEMLFTCGMEELMNDTSTPLCGKHKVLLNGDWVGLCADSESFVGELKSRR
RQSELPLEMEIKRDKDDNEVRIFTDAGRLLRPLLVVENLHKLKQDKPTQYPFKHLLDQGILELIGIEEEEDCTTAWGIKQ
LLKEPKNYTHCELDLSFLLGVSCAIVPFANHDHGKRVLYQSQKHCQQAIGFSSTNPNIRCDTLSQQLFYPQKPLFKTLAS
ECLEKEVLFNGQNAIVAVNVHLGYNQEDSIVMNKASLERGMFRSEQIRSYKAEVDTKDSEKRKKMDELVQFGKTYSKIGK
VDSLEDDGFPFIGANMSTGDIVIGRCTESGADHSIKLKHTERGIVQKVVLSSNDEGKNFAAVSLRQVRSPCLGDKFSSMH
GQKGVLGYLEEQQNFPFTIQGIVPDIVINPHAFPSRQTPGQLLEAALSKGIACPIQKKEGSSAAYTKLTRHATPFSTPGV
TEITEQLHRAGFSRWGNERVYNGRSGEMMRSLIFMGPTFYQRLVHMSENKVKFRNTGPVHPLTRQPVADRKRFGGIRFGE
MERDCLIAHGASANLHERLFTLSDSSQMHICRKCKTYANVIERTPSSGRKIRGPYCRVCASSDHVVRVYVPYGAKLLCQE
LFSMGITLNFDTKLC*

DNA
ATGGCATGCAGGCTTCAGAACATGACATACTCAGCAAGGATCAAAGTCAATGCCCAAGTTGAGGTGTTCAAAAAAATTGT
TATTAAACACGACAAATTCAAGACTGGACAAGATGAATATGTCGAGAAGGAGATACTGGATGTCAAAAAACAGGACATTC
TAATTGGTAGCATACCTGTCATGGTGAAATCTGTCCTTTGCAAAACTAGCGAGAAAGGAAAAGAAAACTGCAAAAAGGGG
AATTGTGCCTTTGATCAGGGTGGATATTTTGTGATAAAGGGGGCTGAGAAGGTGTTTATAGCTCAAGAACAGATGTGCAC
AAAGAGATTGTGGATTTCTAATTCACCATGGACAGTCTCCTTCAGGTCCGAAACTAAAAGAAATAGGTTCATTGTGCGCC
TCTCGGAGAATGAGAAAGCAGAAGACTATAAGATAATGGAGAAAGTACTGACAGTGTACTTCTTGTCGACTGAGATTCCA
GTCTGGCTCCTGTTCTTTGCGTTGGGTGTTTCATCAGACAAAGAAGCCATGGATCTAATTGCTTTCGATGGTGATGATGC
AAGCATTACCAACAGTCTCATAGCTTCTATCCATGAAGCTGATGCAGTGTGTGAAGCTTTTCGCTGTGGGAACAATGCCC
TAACATATGTTGAACATCAGATCAAAAGCACCAAATTCCCTCCTGCTGAAAGTGTGGATGATTGCCTCCGTCTGTATTTG
TTTCCATGCCTCCAAGGTTTGAAGAAGAAAGCCCGATTCCTGGGCTATATGGTGAAGTGCCTTTTGAGCGCGTATGCGGG
AAAACGAAAATGTGAAAACAGGGACAGTTTCCGGAATAAACGAATTGAGCTCGCTGGAGAACTGTTGGAGAGGGAGATAA
GGGTGCATCTTGCACATGCTAGAAGAAAGATGACCAGGGCCATGCAGAAACAACTCTCAGGCGATGGCGATTTGAAGCCT
ATAGAGCATTATTTGGATGCTTCCGTTATCACCAATGGGCTTAATAGAGCCTTCTCCACTGGAGCATGGTCTCATCCTTT
CAGGAAGATGGAAAGGGTCTCAGGTGTTGTAGCTAATTTGGGTCGTGCAAATCCATTGCAGACTCTGATTGATCTGAGGA
GAACGCGACAGCAAGTCCTTTATACCGGCAAGGTTGGAGATGCTAGACATCCGCATCCTTCTCACTGGGGCAGAGTATGC
TTTTTGTCAACTCCAGATGGTGAAAATTGTGGTCTTGTGAAGAACATGTCTCTTCTTGGACTTGTTAGCACTCAAGGTTT
GGAGTCTGTGGTGGAAATGCTCTTTACTTGCGGAATGGAAGAGCTGATGAATGATACCAGCACACCATTGTGTGGCAAAC
ACAAAGTTCTTCTCAATGGAGACTGGGTTGGATTATGTGCAGATTCTGAATCCTTTGTCGGGGAGTTAAAAAGCAGGCGG
CGCCAAAGTGAATTACCTCTCGAGATGGAAATCAAGCGAGATAAAGATGACAATGAGGTGAGAATTTTCACTGACGCTGG
TAGACTACTCCGACCTCTCTTGGTTGTGGAAAATCTCCACAAGTTGAAGCAAGACAAACCTACACAGTATCCTTTTAAGC
ATCTTCTTGACCAAGGGATTCTCGAGCTGATCGGGATTGAGGAAGAAGAAGACTGTACTACAGCATGGGGAATCAAACAG
CTTCTGAAGGAACCAAAGAATTACACGCATTGCGAATTGGACCTATCATTCCTGTTGGGTGTGAGCTGTGCAATTGTCCC
ATTTGCAAATCACGATCATGGGAAAAGAGTTCTTTACCAGTCTCAGAAGCATTGCCAACAAGCCATCGGATTCTCATCAA
CGAACCCTAACATCCGCTGCGATACGCTGTCCCAGCAGCTGTTCTATCCCCAAAAGCCACTTTTCAAGACATTGGCGTCA
GAGTGTCTTGAAAAAGAAGTTCTATTTAATGGCCAGAACGCAATTGTTGCTGTGAATGTTCATCTCGGGTACAACCAAGA
GGACTCCATTGTGATGAACAAGGCTTCATTGGAACGTGGTATGTTCCGTTCAGAGCAGATTAGAAGCTACAAAGCAGAGG
TTGATACTAAAGACTCGGAGAAGAGGAAGAAGATGGATGAGCTTGTTCAGTTTGGAAAGACATACAGCAAAATCGGCAAA
GTAGACAGCCTTGAAGATGACGGGTTTCCTTTCATTGGTGCTAACATGAGTACTGGCGATATTGTCATTGGCAGATGCAC
CGAGTCTGGGGCTGATCACAGTATAAAGCTCAAGCACACTGAGAGAGGAATTGTGCAAAAAGTGGTATTATCTTCTAATG
ATGAAGGGAAGAATTTTGCAGCGGTTTCTCTGAGACAGGTTCGTTCTCCATGCCTTGGAGATAAGTTTTCCAGTATGCAT
GGCCAGAAGGGTGTTTTAGGCTATCTAGAGGAACAGCAGAATTTTCCTTTCACGATCCAAGGCATAGTTCCTGATATTGT
GATAAACCCGCACGCTTTCCCTTCTAGGCAGACACCAGGTCAACTCTTGGAGGCTGCTCTCTCCAAAGGAATCGCTTGTC
CTATACAAAAGAAGGAGGGTAGCTCTGCTGCATACACCAAATTGACACGTCATGCCACTCCTTTCTCCACTCCGGGTGTC
ACTGAAATCACCGAGCAGCTTCACAGGGCCGGCTTTTCAAGATGGGGAAACGAAAGGGTCTACAATGGTAGATCGGGTGA
GATGATGCGCTCTCTGATATTCATGGGCCCAACTTTCTACCAGCGACTTGTCCACATGTCAGAGAACAAAGTCAAGTTCA
GGAACACCGGACCAGTCCACCCGCTCACACGCCAGCCAGTCGCAGACCGGAAGAGGTTTGGCGGGATAAGATTTGGAGAA
ATGGAGCGAGACTGCCTAATAGCTCACGGTGCATCCGCTAATCTGCACGAGCGGCTCTTCACTCTAAGTGACTCTTCTCA
GATGCACATCTGCAGAAAATGCAAGACCTATGCGAATGTGATCGAGAGGACTCCAAGCAGTGGAAGAAAGATCAGAGGGC
CATATTGCAGAGTGTGCGCATCCTCCGACCATGTGGTTAGGGTCTATGTTCCTTATGGAGCTAAGCTTCTTTGTCAGGAG
CTGTTCAGCATGGGCATTACTCTCAACTTCGACACCAAGCTCTGCTGA