Details for Arabidopsis Locus AT3G18070

Position : Chr3 ( 5`- 6187294 .. 6189947 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18070

Protein [Map View]
MFLFLLLLSASRSGEESPSGDAVPLATGGLNRKSFPEGFLFGTATSAYQVEGETHQDGRGPSIWDAFVKIPGKIANNATA
EITVDQYHRYKEDVDLMQNLNIDAYRFSISWSRIFPEGSGKINSNGVAYYNRLIDYLIEKGITPYANLYHYDLPLALEQK
YQGLLSKQGRFCGLRRVLFQTFGDRVKNWMTFNEPRVVAALGYDNGIFAPGRCSEAFGNCTDGNSATEPYIVAHHLILAH
AAAVQRYRQNYQEKQKGRVGILLDFVWFEPLTSSQADNDAAQRARDFHVGWFIHPIVYGEYPNTLQNIVKERLPKFTEEE
VKMVKGSIDFVGINQYTTYFMSDPKISTTPKDLGYQQDWNVTFNFAKNGTPIGPRAHSEWLYNVPWGMYKALMYIEERYG
NPTMILSENGMDDPGNITLTQGLNDTTRVKYYRDYLVQLKKAVDDGANLTGYFAWSLLDNFEWLSGYTSRFGIVYVDYKD
LKRYPKMSALWFKQLLKRDQK*

DNA
ATGTTTCTTTTTCTCCTCCTCCTCTCTGCTTCCCGCTCCGGCGAAGAGTCGCCGTCCGGAGACGCCGTCCCATTGGCCAC
CGGCGGTCTTAACAGAAAGAGTTTTCCGGAAGGATTCTTGTTCGGAACCGCCACGTCAGCTTACCAGGTCGAAGGCGAGA
CCCACCAAGATGGTCGTGGTCCAAGCATTTGGGATGCATTCGTCAAGATTCCTGGTAAGATTGCCAACAATGCCACTGCT
GAGATAACAGTGGACCAATATCATCGTTACAAGGAAGATGTAGATTTGATGCAGAACCTGAACATTGATGCCTACAGATT
TTCCATTTCATGGTCTAGAATATTCCCTGAGGGATCCGGTAAAATCAACTCGAATGGAGTTGCTTATTACAATAGATTGA
TCGATTACTTGATCGAAAAAGGGATTACACCGTATGCTAATCTGTACCACTATGACCTTCCTTTAGCCTTGGAACAAAAG
TATCAAGGCCTGCTTAGTAAACAAGGAAGATTTTGCGGATTACGCAGAGTTTTGTTTCAAACATTTGGAGATAGAGTGAA
GAACTGGATGACGTTTAACGAGCCTCGTGTAGTAGCTGCTCTAGGTTATGATAACGGCATTTTTGCGCCGGGTAGATGCT
CTGAAGCATTTGGAAACTGCACTGATGGAAACTCTGCAACTGAACCATACATTGTTGCACATCACCTTATCTTGGCACAT
GCAGCAGCCGTCCAGAGATACCGCCAAAATTATCAGGAGAAACAAAAGGGAAGGGTTGGGATTCTACTGGATTTTGTTTG
GTTTGAGCCACTTACGAGTAGTCAAGCAGACAATGACGCTGCTCAAAGAGCAAGAGACTTCCATGTTGGATGGTTTATTC
ACCCAATAGTGTATGGAGAGTACCCAAATACGTTGCAAAACATCGTGAAGGAGAGACTTCCGAAGTTCACCGAGGAAGAA
GTGAAAATGGTGAAAGGTTCCATAGACTTCGTGGGGATAAACCAATACACAACTTATTTCATGTCTGATCCTAAAATATC
TACCACACCTAAAGATTTGGGTTATCAACAAGATTGGAACGTCACTTTTAACTTTGCAAAGAATGGGACACCAATTGGTC
CAAGGGCACATTCAGAATGGTTATACAATGTCCCATGGGGAATGTACAAAGCTTTAATGTACATTGAGGAACGTTATGGC
AACCCAACTATGATTCTCTCCGAAAACGGTATGGATGATCCGGGCAACATAACTCTAACTCAAGGACTAAATGATACAAC
AAGAGTCAAGTATTATAGAGACTATTTAGTGCAGCTTAAAAAAGCAGTAGACGATGGAGCCAATCTAACTGGATATTTTG
CGTGGTCGTTGCTAGATAATTTCGAATGGTTATCAGGATATACTTCAAGGTTTGGAATAGTGTACGTTGATTACAAGGAC
TTGAAGAGATACCCCAAGATGTCTGCTTTATGGTTTAAACAACTTTTGAAACGGGACCAGAAATGA