Details for Arabidopsis Locus AT3G18050

Position : Chr3 ( 5`- 6180859 .. 6182854 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18050

Protein [Map View]
MFQHAPSSISLIIIFLFTILSPVSPEPVTVQPFRVKSSPPATIPAFPEQSDFSGCPLDLPEDLFHGIKSACSGKKLHKGK
CCPVLGAWLYSAYSTTALSRSISAAARNSSSSSAAVTTPEEDMPLLPDDSETCVDGLGKSLRQRGIELTRPNETCDVVYC
YCGIRLHPLSCSEAFRVNDEGRLVGDERVDRLETDCLSGSHNNADGFSPLLGCNKCLNSLYKLNPKKTSGTRNPSKEDRN
RTAKMHNKDCVLMGLTWLLAKNRTAYFPTVTSVLRAVMLNHDGVPRSCALGSDGMPLAVDSSEFSNGSPTSLQYPHHLVH
FLLYSVITLVLIRSW*

DNA
ATGTTCCAACACGCGCCTTCTTCCATTTCCCTCATCATCATCTTCCTCTTCACCATTCTATCACCCGTTTCACCTGAACC
GGTCACAGTCCAGCCATTCCGGGTCAAATCATCCCCACCCGCAACCATACCCGCTTTCCCGGAGCAATCCGATTTCTCCG
GCTGCCCACTCGATTTACCAGAAGACCTCTTCCACGGCATCAAGTCAGCTTGCAGCGGCAAAAAGCTCCACAAAGGAAAA
TGTTGCCCCGTACTAGGCGCGTGGCTCTACTCTGCTTACTCAACCACTGCTCTAAGCCGTTCGATTTCCGCCGCCGCAAG
AAACTCATCCTCCTCCTCCGCCGCGGTAACGACTCCTGAAGAAGATATGCCTTTGCTTCCCGATGACTCGGAGACTTGCG
TTGACGGATTAGGGAAATCTCTGAGGCAGAGAGGGATTGAGCTCACTAGACCGAACGAGACTTGCGACGTCGTTTACTGC
TACTGTGGAATCAGATTGCATCCGTTGAGCTGTTCCGAGGCTTTTAGAGTGAATGATGAAGGGAGACTCGTTGGAGACGA
GAGAGTTGATAGATTAGAGACTGATTGTTTGAGTGGAAGCCACAACAATGCTGATGGATTCTCACCTCTTCTTGGTTGCA
ACAAGTGCTTGAACAGTCTCTATAAGCTAAATCCGAAGAAAACTTCAGGGACAAGAAACCCATCAAAGGAAGACCGAAAC
AGAACAGCAAAGATGCACAACAAAGACTGTGTCCTCATGGGTCTCACTTGGCTTCTCGCTAAGAACCGTACTGCTTATTT
CCCCACTGTCACTTCTGTCCTCCGAGCCGTCATGCTGAACCACGATGGCGTGCCACGTTCATGTGCTCTCGGCAGCGACG
GCATGCCTTTAGCCGTCGATTCTTCCGAATTCTCCAACGGCTCGCCAACTTCACTTCAGTATCCGCACCACTTGGTCCAC
TTCTTACTTTACAGCGTTATCACATTAGTCCTAATAAGGTCGTGGTGA