Details for Arabidopsis Locus AT3G18010

Position : Chr3 ( 5`- 6161137 .. 6163272 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18010

Protein [Map View]
MWTMGYNEGGADSFNGGRKLRPLIPRLTSCPTAAVNTNSDHRFNMAVVTMTAEQNKRELMMLNSEPQHPPVMVSSRWNPT
PDQLRVLEELYRQGTRTPSADHIQQITAQLRRYGKIEGKNVFYWFQNHKARERQKRRRQMETGHEETVLSTASLVSNHGF
DKKDPPGYKVEQVKNWICSVGCDTQPEKPSRDYHLEEPANIRVEHNARCGGDERRSFLGINTTWQMMQLPPSFYSSSHHH
HQRNLILNSPTVSSNMSNSNNAVSASKDTVTVSPVFLRTREATNTETCHRNGDDNKDQEQHEDCSNGELDHQEQTLELFP
LRKEGFCSDGEKDKNISGIHCFYEFLPLKN*

DNA
ATGTGGACGATGGGTTACAACGAAGGAGGCGCAGATTCCTTCAACGGAGGAAGAAAGCTTCGTCCTCTCATCCCACGTCT
CACTTCTTGCCCCACCGCCGCCGTAAACACCAACTCCGACCACCGCTTTAATATGGCAGTGGTGACGATGACGGCGGAGC
AGAACAAGAGGGAGCTGATGATGCTAAACTCAGAACCTCAACATCCACCGGTAATGGTGAGCTCACGGTGGAATCCGACA
CCAGATCAGTTAAGGGTTCTTGAAGAGCTTTACCGACAAGGAACTAGAACTCCTTCTGCCGACCACATCCAACAAATCAC
CGCACAGCTACGACGGTACGGGAAGATAGAAGGCAAAAACGTTTTCTATTGGTTCCAAAACCACAAAGCCCGAGAACGCC
AGAAACGACGGCGACAAATGGAAACTGGCCACGAAGAAACGGTCCTTTCAACAGCAAGTCTTGTCTCAAACCACGGATTC
GACAAGAAAGATCCTCCAGGTTACAAGGTTGAACAGGTCAAGAACTGGATATGTTCGGTCGGATGCGACACGCAACCAGA
GAAACCTTCCCGTGATTATCATCTGGAGGAGCCAGCGAATATACGGGTGGAGCACAATGCTCGTTGTGGAGGAGACGAGA
GACGAAGCTTTTTAGGGATAAACACCACGTGGCAGATGATGCAGTTGCCACCTAGTTTCTACTCTTCTTCACATCATCAT
CATCAACGTAACCTCATTCTCAATTCACCTACTGTTTCCTCCAACATGTCCAACAGCAACAATGCTGTCTCTGCTTCTAA
AGATACGGTCACGGTTTCACCTGTATTTCTACGTACGAGAGAAGCAACGAACACAGAGACTTGTCATCGAAATGGTGATG
ATAATAAAGATCAAGAACAACATGAAGATTGCTCCAACGGTGAATTGGATCATCAAGAACAGACACTTGAGCTGTTTCCA
CTGAGAAAAGAAGGGTTTTGTAGCGATGGTGAGAAAGACAAGAACATTAGTGGCATTCACTGTTTCTATGAGTTTCTGCC
ATTGAAGAACTAA