Details for Arabidopsis Locus AT3G18000

Position : Chr3 ( 5`- 6154363 .. 6157552 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18000

Protein [Map View]
MAASYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPYEGKSVLELGAGIGRFTGELAQKAGELIA
LDFIDNVIKKNESINGHYKNVKFMCADVTSPDLKITDGSLDLIFSNWLLMYLSDKEVELLAERMVGWIKVGGYIFFRESC
FHQSGDSKRKSNPTHYREPRFYSKVFQECQTRDAAGNSFELSMIGCKCIGAYVKNKKNQNQICWIWQKVSSENDRGFQRF
LDNVQYKSSGILRYERVFGQGFVSTGGLETTKEFVEKMNLKPGQKVLDVGCGIGGGDFYMAEKFDVHVVGIDLSVNMISF
ALERAIGLSCSVEFEVADCTTKHYPDNSFDVIYSRDTILHIQDKPALFRTFFKWLKPGGKVLISDYCRSPKTPSAEFSEY
IKQRGYDLHDVQAYGQMLKDAGFTDVIAEDRTDQFMQVLKRELDRVEKEKEKFISDFSKEDYDDIVGGWKSKLERCASDE
QKWGLFIANKN*

DNA
ATGGCTGCATCGTACGAAGAAGAGCGTGATATTCAGAAGAATTACTGGATAGAGCATTCCGCTGATCTGACTGTTGAAGC
TATGATGCTTGACTCGAGAGCTTCTGATCTCGACAAGGAAGAACGTCCTGAGGTACTCTCTTTGCTCCCTCCATATGAAG
GCAAATCAGTGTTGGAACTTGGAGCTGGTATTGGTCGTTTCACTGGTGAATTAGCTCAAAAGGCTGGTGAACTCATTGCT
CTTGACTTCATTGATAACGTTATCAAGAAGAATGAAAGTATCAATGGGCATTACAAGAATGTCAAGTTTATGTGTGCTGA
TGTTACATCCCCTGACCTCAAGATCACTGATGGATCTCTTGACTTGATTTTCTCCAACTGGCTGCTCATGTATCTTTCTG
ACAAAGAGGTGGAGCTTTTGGCAGAAAGGATGGTCGGTTGGATCAAGGTTGGAGGATACATTTTCTTCCGTGAATCTTGC
TTCCACCAATCAGGGGACAGTAAGCGGAAATCCAACCCCACTCACTACCGTGAACCCCGTTTCTATTCCAAGGTCTTTCA
AGAGTGTCAGACTCGGGATGCTGCTGGAAATTCATTTGAGCTCTCTATGATCGGATGCAAGTGCATTGGAGCTTATGTCA
AGAACAAGAAGAATCAGAATCAGATTTGTTGGATATGGCAGAAGGTCAGCTCAGAAAATGACAGAGGCTTCCAACGTTTC
TTGGACAATGTCCAATACAAATCCAGTGGAATCCTACGCTATGAGCGTGTCTTTGGCCAAGGGTTTGTGAGCACTGGTGG
ACTTGAGACAACCAAAGAATTTGTGGAGAAAATGAATCTGAAACCAGGACAGAAAGTCTTAGATGTTGGGTGTGGCATTG
GTGGAGGTGACTTCTACATGGCTGAGAAGTTTGATGTTCACGTTGTTGGTATCGATCTTTCTGTCAACATGATCTCTTTC
GCATTGGAACGTGCTATTGGACTCAGCTGCTCGGTTGAGTTTGAGGTTGCTGATTGCACCACAAAACACTACCCAGATAA
TTCGTTTGATGTCATTTACAGCCGTGACACTATTCTGCACATCCAAGACAAACCAGCCTTGTTTAGGACTTTCTTCAAAT
GGCTTAAACCGGGAGGTAAAGTTCTCATCAGCGACTACTGTAGAAGCCCCAAAACTCCATCTGCTGAGTTTTCAGAGTAC
ATCAAACAGAGAGGATATGATCTCCATGACGTTCAAGCTTATGGACAGATGCTAAAAGACGCTGGCTTCACTGATGTGAT
CGCAGAGGACCGTACTGATCAGTTTATGCAAGTCCTGAAACGTGAATTAGACAGGGTGGAGAAAGAAAAGGAAAAATTCA
TCTCCGACTTCTCCAAAGAGGATTACGATGACATTGTTGGAGGATGGAAGTCAAAGCTGGAGAGGTGTGCATCGGATGAG
CAGAAATGGGGACTTTTCATCGCCAACAAGAATTAA