Details for Arabidopsis Locus AT3G17980

Position : Chr3 ( 5`- 6152121 .. 6153434 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G17980

Protein [Map View]
MTTACPARTSSLMDDLLGLLRIRIKRGVNLAVRDISSSDPYVVVKMGKQKLKTRVINKDVNPEWNEDLTLSVTDSNLTVL
LTVYDHDMFSKDDKMGDAEFEIKPYIEALRMQLDGLPSGTIVTTVKPSRRNCLAEESRVTWVDGKLVQDLVLRLRHVECG
EVEAQLQWIDLPGSKGL*

DNA
ATGACAACGGCGTGTCCGGCGAGGACAAGCTCACTAATGGACGATCTCTTGGGCCTCCTTAGAATCCGTATCAAACGTGG
CGTCAATTTAGCCGTCCGTGACATCAGTAGCAGCGATCCTTACGTCGTCGTCAAGATGGGCAAACAGAAATTGAAGACTC
GTGTCATTAACAAAGATGTTAATCCAGAATGGAATGAAGATTTGACTCTCTCCGTCACAGACTCCAATCTTACCGTCCTC
TTGACGGTGTATGATCACGACATGTTTAGCAAAGACGACAAGATGGGCGATGCTGAGTTCGAGATAAAGCCCTATATTGA
GGCTTTGAGGATGCAACTCGATGGACTTCCTAGTGGAACCATTGTGACCACGGTTAAGCCAAGTCGTCGTAACTGTCTAG
CCGAGGAGTCACGTGTCACCTGGGTCGACGGCAAGCTCGTCCAGGATCTCGTTCTCAGATTGCGACATGTGGAATGCGGA
GAGGTCGAGGCTCAGCTTCAATGGATTGACCTCCCTGGCTCCAAGGGTCTATGA