Details for Arabidopsis Locus AT3G17940

Position : Chr3 ( 5`- 6143519 .. 6145337 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G17940

Protein [Map View]
MADQSKNTPEIFELNNGTMQVKISNYGTTITSLSVPDKNGKLGDVVLGFDSVDPYVKGLAPYFGCIVGRVANRIKEGKFS
LNGVNYTLPINKPPNSLHGGNKGFDKKIWEVAGHKRDGEKPFITFKYHSADGEEGYPGAVSVTATYTLTSATTMRLDMEA
VPENKDTPINLAQHTYWNLAGHDSGNILDHKIQIWGSHITPVDEYTVPTGEILPVKGTPFDFTEEKRIGESIGEVGIGYD
HNYVLDCPDQEKEGLKHAAKLSDAASSRVLNLWTNVPGMQFYTGNYVNGVVGKGNAVYGKHAGVCLETQGFPNAINQSNF
PSVVVKAGEKYNHTMLFEFSA*

DNA
ATGGCGGATCAGAGCAAAAACACTCCAGAGATCTTCGAGCTCAACAATGGCACCATGCAGGTCAAGATCTCAAACTACGG
CACCACCATCACCTCTTTGTCTGTTCCCGACAAGAACGGGAAACTGGGGGATGTAGTTCTCGGATTCGACTCGGTGGATC
CATATGTGAAAGGGCTTGCACCATACTTTGGGTGCATTGTTGGTCGTGTGGCAAATCGGATCAAGGAGGGAAAATTCAGT
CTCAATGGAGTTAACTACACTTTGCCTATCAACAAGCCTCCTAATAGTCTCCACGGTGGTAACAAGGGTTTCGATAAGAA
GATATGGGAAGTTGCAGGGCACAAGAGAGACGGCGAAAAACCTTTCATCACTTTCAAATATCACAGTGCCGATGGAGAAG
AAGGTTACCCTGGTGCGGTTTCTGTCACGGCGACATACACTCTCACGTCAGCCACGACAATGAGACTTGACATGGAAGCT
GTTCCAGAGAACAAAGATACTCCCATCAACTTAGCTCAACATACATACTGGAACTTAGCAGGTCATGACTCAGGAAACAT
TCTAGACCATAAGATTCAGATATGGGGGTCTCATATCACGCCGGTTGACGAATACACAGTTCCTACAGGAGAGATCTTGC
CTGTAAAGGGAACTCCTTTCGATTTCACTGAGGAGAAGCGGATAGGCGAGTCTATTGGAGAGGTTGGTATCGGATACGAT
CATAACTACGTGTTGGACTGTCCTGATCAAGAGAAGGAGGGGCTGAAACACGCAGCGAAGCTCAGTGATGCTGCTAGCTC
AAGGGTACTGAACTTGTGGACCAATGTGCCGGGAATGCAGTTTTATACCGGGAACTATGTGAATGGAGTGGTTGGGAAAG
GGAATGCGGTTTACGGGAAACATGCGGGTGTGTGCCTTGAGACGCAGGGATTCCCGAACGCGATTAACCAGTCGAATTTC
CCGTCTGTTGTGGTTAAGGCTGGTGAGAAGTACAATCACACGATGCTGTTTGAGTTTTCAGCTTGA