Details for Arabidopsis Locus AT3G17930

Position : Chr3 ( 5`- 6142129 .. 6143310 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G17930

Protein [Map View]
MASLPFGVSNLCRNQEVLSASVRLLPVGRQTTGFGAAKKVLYRFEGHRLSSSVEKGEKQRMRCRVSSNSTETEDDSATKT
KTTPFGYTRKDVILIGVGVTALGIGLESGLEYVGVDPLQAGNAVQLILVLGLTLGWISTYIFRVGNKEMTYAQQLRDYES
QVMQKRLESLSEAELEALMAQVDEEKTKVE*

DNA
ATGGCTTCTTTACCGTTCGGAGTTTCGAATCTATGCAGAAATCAGGAGGTTCTGTCTGCGTCTGTAAGGCTTCTTCCGGT
TGGGCGACAAACCACAGGATTCGGAGCTGCGAAGAAAGTCTTATATAGATTCGAGGGACATAGATTGTCATCATCAGTAG
AAAAGGGAGAGAAACAGAGAATGAGATGTAGAGTTAGCTCAAACTCTACTGAAACTGAAGACGATTCTGCTACAAAAACC
AAGACGACGCCGTTTGGTTACACGAGGAAGGATGTTATATTGATAGGAGTGGGAGTGACTGCACTTGGTATCGGGCTAGA
GAGTGGACTTGAGTATGTGGGAGTTGATCCGTTGCAAGCGGGGAATGCAGTACAGCTGATACTGGTGCTTGGTTTGACTT
TGGGTTGGATTTCGACTTATATCTTTAGAGTCGGTAACAAGGAGATGACTTATGCCCAGCAACTTCGTGACTACGAGTCT
CAAGTCATGCAGAAACGATTGGAGAGCTTATCGGAGGCAGAGTTAGAGGCATTGATGGCACAGGTTGATGAAGAGAAGAC
CAAGGTTGAGTAG