Details for Arabidopsis Locus AT3G17850

Position : Chr3 ( 5`- 6109705 .. 6116458 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G17850

Protein [Map View]
MVFKNKLFFSSKKSGSSSPDSSNSPRSVGSNSPIRSDKKKSKSASKDEPPIPIPGFVGVGCKQTQIKDGLKKKDGSSKGK
QLSSEVQAHSIGKSNLSPSSEVKKPPPPEVKEGPAFVSPIMASSLGLNRIKTRSGPLPQERVFNYRNDPATSNLSKMGAD
GGDLGSGSATSGSGSGNRKKEAGSSKLGLEENMDRTRPSDNKSDRDSLSPDTGPPRSLSPTLPPSGSRLQNVASSSGTGR
SEMSSGRSGPLRNSDFCTPENSYEWENPKESESPRYQALLRMTSAPRKRFPGDIKSFSHELNSKGVRPFPLWKPRRSNNV
EEVLNLIRAKFEKAKEEVNSDLAVFAADLVGVLEKNAESHPEWEETFEDLLILARSCAMTTPGDFWLQCEGIVQDLDDRR
QELPPGVLKQLHTRMLFILTRCTRLLQFHKESWGEEEQVVQLRQSRVLHSIEKIPPSGAGRSYSAAKVPSTKKAYSQEQH
GLDWKEDAVVRSVPPLAPPENYAIKESESPANIDRMSSWKKLPSPALKTVKEAPASEEQNDSKVEPPNIVGSRQGRDDAA
VAILNFPPAKDSHEHSSKHRHNISWGYWGEQPLISEESSIMCRICEEEVPTTHVEDHSRVCTLADKYDQKGLSVDERLMA
VAGTLDKIAETFRHKDSLAAAESPDGMKVSNSHLTEESDVLSPRLSDWSRKGSEDMLDCFPEADNSIFMDDLRGLPLMSC
RTRFGPKSDQGMTTSSASSMTPRSPIPTPRPDPIEQILGGKGTFHDQDDIPQMSELADIAKCAADAIPGDDQSIPFLLSC
LEDLRVVIDRRKFDALTVETFGTRIEKLIREKYVHMCELMDDEKVDLLSTVIDEDAPLEDDVVRSLRTSPVHPRDRTSID
DFEIIKPISRGAFGRVFLAKKRTTGDLFAIKVLKKADMIRKNAVESILAERDILINVRNPFVVRFFYSFTCRDNLYLVME
YLNGGDLYSLLRNLGCLEEDIVRVYIAEVVLALEYLHSEGVVHRDLKPDNLLIAHDGHIKLTDFGLSKVGLINSTDDLAG
PAVSGTSLLDEEESRLAASEEQLERRKKRSAVGTPDYLAPEILLGTGHGATADWWSVGIILFELIVGIPPFNAEHPQQIF
DNILNRKIPWPHVPEEMSAEAHDIIDRFLTEDPHQRLGARGAAEVKQHIFFKDINWDTLARQKAAFVPASESAIDTSYFR
SRYSWNTSDEQFFPSGEVPDYSDADSMTNSSGCSSNHHEEGEAEECEGHAEFESGIPVDYSFSNFSFKNLSQLASINYDL
LSKGWKDEPQQIPHHK*

DNA
ATGGTATTCAAGAACAAACTCTTCTTCTCTTCGAAGAAATCTGGATCTTCTAGTCCCGATAGCTCTAATAGTCCCAGATC
TGTTGGCTCCAACTCTCCGATACGATCAGATAAGAAGAAGTCTAAATCCGCTTCCAAGGATGAACCTCCGATCCCTATTC
CTGGATTTGTTGGAGTTGGTTGCAAGCAGACGCAGATTAAAGATGGTTTGAAGAAGAAGGATGGTTCATCTAAGGGTAAA
CAACTTTCATCTGAAGTTCAAGCTCACTCTATTGGAAAATCGAACTTGTCTCCTAGTTCCGAGGTGAAGAAACCACCTCC
GCCGGAAGTGAAGGAAGGACCTGCTTTTGTTTCTCCAATCATGGCTTCGTCTCTTGGGTTGAACCGGATTAAGACGAGAT
CCGGACCTTTGCCACAGGAAAGGGTTTTCAATTATAGGAATGATCCGGCTACGAGCAATTTGTCGAAGATGGGTGCTGAT
GGTGGTGACTTGGGCTCGGGTTCAGCTACTTCTGGCTCTGGTAGTGGCAATAGAAAGAAAGAAGCTGGGAGTAGCAAGCT
AGGGTTAGAAGAGAACATGGATCGCACTCGACCAAGTGACAATAAGAGTGATCGTGATAGTTTGTCTCCTGATACAGGAC
CACCGAGGAGCCTCAGCCCTACTTTGCCGCCATCAGGATCTCGATTGCAGAATGTAGCATCCTCATCGGGAACTGGTCGC
TCTGAGATGTCATCCGGTCGTTCTGGCCCTCTAAGAAATTCAGACTTTTGCACCCCAGAGAATTCATATGAATGGGAAAA
TCCCAAAGAGTCAGAATCGCCTCGTTATCAAGCCTTACTTCGTATGACCAGTGCTCCACGAAAGAGGTTTCCTGGTGACA
TCAAAAGCTTTTCTCATGAGTTGAACTCAAAAGGTGTACGTCCCTTTCCATTATGGAAGCCTCGTAGGTCGAACAATGTG
GAGGAAGTATTGAATCTGATTCGGGCAAAATTTGAGAAAGCAAAGGAAGAAGTAAACTCTGACCTTGCAGTATTTGCAGC
GGACCTGGTGGGAGTTCTTGAGAAAAATGCAGAAAGCCATCCTGAGTGGGAGGAAACATTTGAAGACTTGCTAATTTTGG
CTCGAAGTTGTGCTATGACTACTCCTGGAGATTTCTGGCTTCAGTGTGAAGGCATTGTTCAGGACTTAGATGATAGACGT
CAAGAGCTTCCCCCGGGCGTCCTCAAGCAGCTTCATACTCGGATGCTTTTTATCCTTACCAGATGTACTAGATTACTTCA
GTTTCATAAGGAAAGCTGGGGGGAGGAGGAACAAGTTGTACAACTACGTCAGTCAAGAGTCTTGCATTCTATAGAGAAAA
TACCGCCGAGTGGAGCGGGAAGGAGTTACAGTGCTGCAAAGGTACCATCTACCAAGAAAGCTTATAGTCAGGAGCAGCAT
GGTTTGGACTGGAAGGAAGACGCTGTTGTACGCTCAGTTCCCCCTCTTGCTCCTCCTGAAAATTATGCTATAAAGGAATC
TGAATCTCCTGCAAACATTGATAGAATGTCTTCCTGGAAAAAACTTCCATCTCCAGCACTGAAAACTGTGAAAGAAGCGC
CAGCGTCAGAAGAGCAGAATGATAGCAAAGTTGAACCTCCAAATATAGTTGGGAGTCGACAAGGTAGGGATGATGCCGCT
GTTGCTATTCTCAACTTTCCTCCAGCAAAAGATTCTCATGAACACTCCTCCAAGCATCGGCACAATATTTCTTGGGGTTA
CTGGGGGGAACAACCCCTTATTTCGGAGGAAAGTTCAATAATGTGCCGTATCTGTGAGGAGGAAGTTCCGACAACTCATG
TGGAAGATCACTCTAGGGTTTGTACATTGGCTGATAAATATGACCAGAAAGGACTGAGTGTTGATGAGCGACTGATGGCA
GTTGCTGGTACACTTGACAAGATAGCAGAGACCTTCAGGCATAAGGATAGCCTAGCAGCCGCAGAGAGCCCAGATGGTAT
GAAAGTATCCAATTCACATCTGACTGAAGAATCTGATGTTCTCTCTCCAAGGTTGAGTGATTGGTCGCGAAAAGGATCAG
AAGACATGCTTGACTGTTTTCCGGAGGCTGATAATTCAATTTTTATGGATGATCTGAGAGGTTTACCGCTAATGTCATGT
AGAACCCGTTTTGGTCCCAAGTCTGATCAAGGTATGACAACTTCATCTGCCAGTAGCATGACTCCTAGATCCCCGATTCC
GACCCCTAGGCCTGATCCAATTGAACAGATATTAGGAGGCAAGGGTACATTCCACGATCAAGATGATATTCCACAGATGA
GTGAACTTGCTGACATTGCAAAATGTGCAGCAGATGCCATTCCGGGTGATGATCAATCCATTCCATTCCTACTGTCTTGT
CTTGAAGATCTAAGGGTTGTCATAGACCGCAGAAAGTTTGATGCACTTACAGTAGAAACATTTGGGACTCGCATAGAAAA
GTTGATCCGTGAGAAATATGTGCATATGTGTGAGCTTATGGATGATGAAAAAGTTGATCTACTAAGCACTGTAATTGATG
AAGATGCTCCCTTAGAAGATGATGTTGTTCGGAGCTTGAGGACCAGCCCAGTACATCCGCGAGATCGCACATCCATTGAT
GATTTTGAGATCATAAAACCAATAAGTCGGGGAGCTTTTGGGCGAGTTTTTTTAGCGAAAAAGAGGACAACAGGAGATCT
ATTCGCAATCAAGGTTCTGAAAAAGGCAGATATGATTCGTAAGAATGCTGTTGAAAGTATACTTGCTGAACGTGATATAT
TGATCAACGTTCGCAATCCTTTTGTGGTTCGTTTCTTCTATTCTTTCACGTGTCGTGACAACCTGTATTTGGTGATGGAG
TATCTGAATGGAGGGGATCTGTATTCGTTGTTGAGAAATTTAGGTTGCTTAGAAGAAGATATTGTCCGTGTATATATTGC
TGAAGTTGTCCTTGCTTTGGAATATTTGCATTCTGAGGGTGTTGTTCACCGTGATTTGAAGCCGGATAATTTGTTGATTG
CGCATGATGGTCATATAAAGTTAACAGATTTCGGGCTCTCTAAAGTTGGTCTCATCAACAGCACAGATGATCTGGCTGGT
CCTGCTGTAAGTGGGACGTCTCTGCTTGATGAGGAGGAATCACGATTAGCGGCATCTGAGGAACAACTTGAAAGGCGCAA
GAAACGGTCTGCTGTGGGTACTCCTGACTACTTAGCGCCAGAAATTCTTTTAGGGACAGGACATGGTGCAACTGCGGATT
GGTGGTCTGTTGGCATCATTCTGTTTGAACTCATTGTGGGAATTCCACCCTTCAATGCGGAACATCCTCAGCAAATATTT
GATAATATTCTCAACCGTAAGATACCATGGCCTCATGTTCCAGAAGAAATGAGTGCTGAAGCCCATGATATAATAGACCG
ATTTTTAACAGAAGATCCACATCAGAGACTTGGAGCTAGAGGGGCAGCTGAGGTCAAGCAGCACATCTTCTTTAAAGACA
TCAACTGGGACACACTAGCAAGGCAAAAGGCTGCATTTGTTCCGGCTTCAGAGAGTGCAATTGACACAAGTTACTTCAGA
AGTCGCTACTCGTGGAACACATCAGATGAGCAATTTTTCCCAAGCGGTGAGGTTCCAGATTATAGTGATGCTGATAGCAT
GACTAACAGCAGTGGTTGCTCGAGCAATCATCATGAAGAAGGGGAGGCTGAAGAATGCGAAGGTCATGCAGAGTTTGAGT
CTGGCATACCTGTAGATTACTCTTTCAGTAATTTCTCGTTTAAGAACCTCTCTCAGTTGGCGTCTATCAACTATGATCTT
TTATCCAAAGGCTGGAAAGATGAGCCACAACAAATTCCGCATCACAAGTAA