Details for Arabidopsis Locus AT3G17840

Position : Chr3 ( 5`- 6106028 .. 6108675 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G17840

Protein [Map View]
MRLFFTPSMSNLSIFFSILLLSLPLPSIGDLAADKSALLSFRSAVGGRTLLWDVKQTSPCNWTGVLCDGGRVTALRLPGE
TLSGHIPEGIFGNLTQLRTLSLRLNGLTGSLPLDLGSCSDLRRLYLQGNRFSGEIPEVLFSLSNLVRLNLAENEFSGEIS
SGFKNLTRLKTLYLENNKLSGSLLDLDLSLDQFNVSNNLLNGSIPKSLQKFDSDSFVGTSLCGKPLVVCSNEGTVPSQPI
SVGNIPGTVEGSEEKKKRKKLSGGAIAGIVIGCVVGLSLIVMILMVLFRKKGNERTRAIDLATIKHHEVEIPGEKAAVEA
PENRSYVNEYSPSAVKAVEVNSSGMKKLVFFGNATKVFDLEDLLRASAEVLGKGTFGTAYKAVLDAVTLVAVKRLKDVTM
ADREFKEKIEVVGAMDHENLVPLRAYYYSGDEKLLVYDFMPMGSLSALLHGNKGAGRPPLNWEVRSGIALGAARGLDYLH
SQDPLSSHGNVKSSNILLTNSHDARVSDFGLAQLVSASSTTPNRATGYRAPEVTDPRRVSQKADVYSFGVVLLELLTGKA
PSNSVMNEEGMDLARWVHSVAREEWRNEVFDSELMSIETVVSVEEEMAEMLQLGIDCTEQHPDKRPVMVEVVRRIQELRQ
SGADRVG*

DNA
ATGCGACTCTTCTTCACACCGTCAATGTCCAATCTCTCCATATTCTTCTCGATTCTTCTCCTTTCTCTTCCTCTTCCGTC
AATCGGAGATCTCGCCGCCGACAAATCCGCTCTTCTCTCTTTTCGTTCCGCCGTCGGTGGTCGTACATTACTCTGGGACG
TCAAGCAAACCTCACCATGCAACTGGACCGGCGTCTTATGCGACGGTGGTCGTGTTACTGCTCTTCGTCTTCCCGGTGAA
ACGCTCTCCGGTCATATACCGGAGGGTATTTTTGGTAATTTAACTCAGCTCCGGACGCTTAGTCTCCGTCTCAATGGTCT
TACTGGTTCTCTTCCTTTGGATCTCGGAAGCTGCTCCGATCTTCGGCGTTTGTACCTGCAGGGTAACAGATTCTCCGGTG
AGATTCCGGAGGTTTTGTTTAGTCTTAGTAACCTTGTTAGGTTGAATCTAGCTGAGAATGAATTTAGTGGAGAGATCTCG
TCAGGGTTTAAAAACCTTACTAGGCTTAAGACTCTGTACCTGGAGAATAACAAGCTCTCTGGCTCTCTTTTAGACTTGGA
TTTGTCTTTGGATCAGTTCAACGTTTCTAATAACTTGTTGAACGGATCTATACCTAAGAGTTTGCAGAAGTTTGATTCTG
ATTCGTTTGTGGGAACTTCTCTCTGCGGCAAACCGCTTGTTGTCTGCTCTAATGAGGGAACTGTGCCAAGCCAGCCAATT
TCTGTTGGCAATATTCCCGGAACTGTTGAAGGAAGTGAGGAGAAGAAGAAAAGGAAGAAGCTTTCTGGTGGAGCTATAGC
TGGAATAGTGATTGGATGTGTGGTTGGTTTGTCCCTGATTGTTATGATTTTGATGGTTCTCTTTAGGAAAAAGGGGAACG
AGAGAACAAGGGCCATTGACCTTGCAACCATCAAGCACCATGAAGTTGAAATTCCTGGCGAGAAAGCGGCCGTGGAAGCA
CCGGAGAATAGGAGCTATGTAAATGAGTACTCTCCGTCTGCAGTGAAAGCTGTGGAAGTGAACAGTTCAGGGATGAAGAA
GTTAGTGTTTTTTGGGAATGCGACAAAGGTCTTCGATCTTGAGGATCTGTTGAGAGCTTCAGCGGAGGTTCTGGGGAAAG
GAACGTTCGGGACAGCTTATAAAGCGGTGCTTGACGCGGTGACATTGGTGGCTGTGAAGAGACTGAAGGATGTAACGATG
GCGGACAGAGAGTTTAAGGAGAAGATTGAGGTTGTTGGGGCGATGGATCATGAGAACTTGGTGCCCTTGAGAGCGTACTA
TTACAGTGGAGACGAGAAGCTGCTTGTCTATGACTTCATGCCTATGGGAAGCTTATCAGCTCTCTTACACGGAAACAAAG
GTGCAGGCCGGCCTCCATTGAACTGGGAAGTCAGATCAGGCATCGCCCTTGGAGCTGCTCGTGGCTTAGACTATCTTCAC
TCACAAGACCCACTGAGCTCTCACGGAAACGTCAAGTCCTCCAATATCCTCTTAACAAACTCCCATGACGCACGAGTGTC
TGATTTCGGCCTGGCTCAGCTTGTAAGCGCCTCATCCACAACCCCAAACCGGGCCACTGGGTACCGTGCGCCAGAAGTAA
CTGACCCGAGGCGTGTCTCACAGAAAGCGGACGTGTACAGCTTTGGTGTGGTGTTGCTAGAGTTGCTCACCGGAAAAGCT
CCGTCTAACTCGGTGATGAACGAGGAAGGAATGGATTTGGCGAGGTGGGTGCATTCAGTGGCGAGAGAGGAGTGGAGGAA
TGAGGTTTTTGACTCGGAGCTGATGAGTATCGAGACAGTTGTCTCGGTGGAAGAAGAGATGGCGGAAATGCTGCAGCTGG
GCATTGACTGTACAGAGCAGCACCCAGACAAGCGGCCAGTTATGGTGGAGGTGGTGAGAAGGATCCAGGAGTTGCGCCAA
TCGGGTGCAGATCGGGTGGGGTAA