Details for Arabidopsis Locus AT3G17790

Position : Chr3 ( 5`- 6089605 .. 6091231 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G17790

Protein [Map View]
MNSGRRSLMSATASLSLLLCIFTTFVVVSNGELQRFIEPAKSDGSVSFIVIGDWGRRGSFNQSLVAYQMGKIGEKIDLDF
VVSTGDNFYDNGLFSEHDPNFEQSFSNIYTAPSLQKQWYSVLGNHDYRGDAEAQLSSVLREIDSRWICLRSFVVDAELVE
MFFVDTTPFVKEYYTEADGHSYDWRAVPSRNSYVKALLRDLEVSLKSSKARWKIVVGHHAMRSIGHHGDTKELNEELLPI
LKENGVDLYMNGHDHCLQHMSDEDSPIQFLTSGAGSKAWRGDINPVTINPKLLKFYYDGQGFMSARFTHSDAEIVFYDVF
GEILHKWVTSKQLLHSSV*

DNA
ATGAATTCTGGTCGTCGATCGTTAATGTCCGCCACGGCGAGTCTGAGTTTGCTGTTGTGTATCTTCACCACCTTCGTCGT
GGTGTCGAACGGTGAGCTTCAGAGATTTATAGAGCCGGCTAAAAGCGACGGTTCCGTTAGTTTTATAGTCATCGGAGATT
GGGGTCGTCGTGGCTCCTTCAATCAGTCTCTCGTTGCTTATCAGATGGGAAAAATTGGAGAGAAGATTGACTTAGATTTC
GTGGTGTCTACGGGAGATAACTTCTACGACAATGGATTGTTTAGTGAACATGATCCAAACTTCGAACAATCTTTCTCTAA
CATCTACACTGCTCCAAGTCTTCAGAAACAGTGGTACAGTGTTTTGGGAAACCATGACTATAGAGGTGACGCAGAAGCTC
AGCTGAGTTCTGTTCTCCGGGAAATCGACAGCCGTTGGATTTGTCTTCGATCATTTGTCGTTGATGCAGAGTTGGTAGAG
ATGTTCTTTGTTGACACGACTCCTTTCGTGAAAGAATACTACACAGAAGCAGATGGTCACTCATATGATTGGCGCGCAGT
TCCATCTCGCAACTCTTATGTCAAAGCTCTTCTCCGTGATCTTGAAGTTTCCTTAAAGAGTTCTAAAGCAAGATGGAAGA
TTGTTGTTGGTCACCATGCAATGAGAAGCATTGGACATCATGGAGATACTAAAGAGCTCAACGAAGAGCTTCTTCCGATT
CTTAAAGAGAACGGTGTTGATCTCTACATGAATGGACATGATCATTGTCTTCAACATATGAGTGATGAAGACAGTCCTAT
TCAGTTTCTAACTAGTGGTGCTGGATCCAAGGCTTGGAGAGGAGATATTAACCCAGTGACCATCAATCCCAAGCTACTGA
AATTCTATTATGATGGTCAAGGATTCATGTCTGCTCGGTTCACTCACTCGGACGCAGAGATCGTCTTCTACGATGTCTTT
GGTGAGATTTTGCACAAATGGGTCACTTCTAAACAACTTCTTCATTCCTCTGTTTGA