Details for Arabidopsis Locus AT3G17770

Position : Chr3 ( 5`- 6081671 .. 6086138 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G17770

Protein [Map View]
MDFAAKKFINNPNDVVTEFIEGLVETYPGLQYLDGFPEVKVVLRADVSAAKYDKVAVISGGGSGHEPAHAGYVGEGMLTA
AICGDVFASPPVDSILAGIRAVTGTEGCLLIVKNYTGDRLNFGLAAEQAKSEGYKVETVIVGEDCALPPPRGIAGRRGLA
GTVLVHKVAGAAAAAGLSLEKVAAEAKCASEMVGTMGVALSVCTLPGQVTSDRLGAQKMELGLGIHGEPGAAVVDVEPVD
VVVSHVLQQILSPETNYVPITRGNRVVLMVNGLGGTPLMELMIAAGKAVPKLQLEFGLAVDRVYTGFFMTSLDMAGFSIS
IMKADHSILDRLDAPTKAPNWPVGTDGNRPPAKIPVPVPPSRSIKSMESQSRPLELSKEGQVLEAAIQAAATVIISLKDS
LNEWDGKVGDGDCGSTMYRGATAILEDMKNYYPLNDAAETVNEIGLSIKRAMGGTSGIIYHLLCKAAYAELKANAQSEVT
PKNWSEALKSSIASVSKYGGATAGYRTMLDALIPASQVLEEKLSAGEDPISAFILSGEAATAGAESTIQMQAQAGRSSYV
SAENLATVPDPGAMAAAGWYNAAARAVKEQYEGSS*

DNA
ATGGATTTCGCAGCCAAGAAATTCATCAACAACCCCAACGATGTTGTAACTGAGTTCATAGAGGGTCTGGTAGAAACTTA
TCCTGGACTCCAGTATTTGGATGGTTTTCCTGAGGTTAAGGTGGTGCTACGAGCTGATGTCTCGGCTGCAAAATATGACA
AGGTTGCCGTTATCTCAGGTGGAGGCAGTGGGCATGAGCCAGCACATGCTGGATACGTTGGAGAAGGAATGCTAACAGCT
GCTATTTGTGGAGATGTCTTTGCCTCCCCACCAGTTGATTCTATCCTTGCTGGAATTCGAGCTGTAACTGGTACTGAGGG
ATGTCTATTGATTGTCAAGAATTATACGGGTGATCGCTTGAACTTTGGTTTGGCTGCTGAACAAGCAAAATCTGAAGGTT
ACAAAGTTGAGACTGTAATTGTTGGAGAGGATTGCGCTTTACCCCCGCCACGTGGCATCGCTGGACGCAGAGGGTTAGCA
GGAACAGTTCTTGTCCATAAGGTTGCGGGGGCAGCAGCAGCTGCTGGTCTTTCTCTAGAAAAAGTTGCTGCTGAGGCAAA
ATGTGCGTCAGAGATGGTTGGTACCATGGGTGTTGCATTATCCGTCTGTACACTTCCTGGACAGGTTACATCAGATCGTC
TTGGCGCACAGAAGATGGAACTCGGGCTTGGAATTCATGGAGAACCTGGTGCTGCTGTGGTTGACGTTGAACCTGTGGAT
GTGGTGGTGTCCCATGTTCTTCAGCAAATACTTAGTCCTGAGACCAATTATGTTCCAATTACTCGTGGTAACAGAGTGGT
TCTCATGGTCAATGGTTTGGGAGGCACACCTTTAATGGAACTTATGATTGCTGCTGGAAAAGCAGTCCCTAAACTGCAGT
TGGAATTTGGACTTGCCGTTGATAGGGTGTATACAGGCTTTTTTATGACTTCTCTTGATATGGCAGGATTCTCGATTTCA
ATCATGAAGGCTGACCATTCGATTTTAGACCGATTGGATGCTCCAACCAAGGCTCCAAATTGGCCAGTTGGCACTGATGG
CAACCGGCCACCAGCGAAGATTCCTGTTCCTGTTCCTCCTTCTCGATCAATAAAAAGCATGGAGTCTCAAAGCCGACCTC
TAGAGCTGAGTAAAGAAGGTCAAGTTCTTGAGGCAGCTATTCAAGCAGCAGCAACTGTGATCATCAGCCTTAAGGATAGT
TTGAATGAATGGGATGGAAAAGTAGGCGATGGTGATTGTGGGTCAACAATGTACAGAGGTGCAACAGCTATTCTGGAGGA
CATGAAAAACTATTATCCACTCAATGATGCTGCGGAAACAGTGAATGAGATTGGTCTATCAATCAAAAGAGCCATGGGGG
GCACAAGCGGAATAATTTACCATCTCCTCTGCAAGGCAGCATACGCGGAGCTAAAAGCTAACGCTCAGTCAGAAGTCACT
CCCAAAAATTGGTCTGAAGCACTCAAGTCATCAATCGCTTCAGTCAGCAAATATGGTGGAGCAACTGCGGGCTACAGAAC
GATGCTAGATGCGCTCATCCCAGCTTCACAAGTTCTTGAGGAGAAACTGAGCGCTGGAGAGGATCCAATATCTGCTTTCA
TTCTATCAGGCGAAGCGGCAACTGCCGGAGCGGAATCAACCATACAGATGCAAGCACAGGCTGGGAGATCAAGCTATGTA
TCTGCAGAGAATCTTGCAACGGTTCCAGATCCAGGTGCAATGGCAGCAGCGGGATGGTACAATGCGGCAGCAAGAGCCGT
AAAGGAGCAGTATGAGGGCTCGTCATGA