Details for Arabidopsis Locus AT3G17750

Position : Chr3 ( 5`- 6073769 .. 6078722 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G17750

Protein [Map View]
MEDSSSIDSILEFLRKNHFMRAEAALISELSKKPSSNGSLQKLNFEDNCVSKLLDKKKQGGSSQALGLHNDSHISDELVV
KEIQCGAANNLHESNLMNDVSVQTQSGNADFWEERFTFAEGFEDTELDLPPWNHTSTDIVADSEEYSINPSKRGFVNPRS
SKQSSHEKVPEPGKSNKVVVEDVFSSFEKIRTGSSSQVSQYDHGKACQSLEVDNKVGNSAIQEGFVTTSWSRSEENIGAS
PDHWKDCSVTTVFPLSKGSTSTKDNGVAILDKWQGKKLVGASDSRILIKEQEDDVATALYLGKSQSGYEHKIPSSLAFSL
AHDAPREDLPRLPHVKIKSEDKLMNFTWEEKHERDILDEKLINTDNAFLLGSYLDVPIGQEINSSGGKMAGGGNWLSVSH
GIADDASDLIFGFGDGLGALNEHSNEYWDSDEYDDDDDVGYIRQPIEDEAWFLGHEVDYPSDNEKGTEHGSVPDTQDKSQ
TKNDDDHSFAEEDSYFSGEQYVLAKGIEPVTASNDPMGLSMTETYSTTKQADLVARYDGQLMDAEELSLMDTEPVWKGFV
SHENDVILLKKGKVEDNSGRICRKDIRAEDDRNAAVRSIGVGMSDDVDDNGSIIPEYFPGEGSEWDLELLPYRGVGVAGV
KPPPGKGASMLLKNFADGGFSFPSPVADRQKSQDDSANPEWSNHCDAVVRNESDEPKGLIQSDSMIVSSTKRCSGSSSER
NLRDMDDEKVASSRNSSPSALSHSSDTGREHKEEDEEETSHGPEEDPGTSFEDEDAIVVQEQVRQIQAQEQDFETFNLKI
VHRKNRTGFEEDKNFHVVLNSVIAGRYHVTEHLGSAAFSKAIQAHDLHTGIDVCVKIIKNNKDFFDQSLDEIKLLKYVNQ
HDPADKYHLLRLYDYFYFREHLLIVCELLKANLYEFQKFNRESGGEVYFTMPRLQSITIQCLEALNFLHGLGLIHCDLKP
ENILIKSYSRCEIKVIDLGSSCFETDHLCSYVQSRSYRAPEVILGLPYDKKIDIWSLGCILAELCTGNVLFQNDSPATLL
ARVIGIIGSIDQEMLAKGRDTCKYFTKNHLLYERNQESNNLEYLIPKKSSLRRRLPMGDQGFIDFVAYLLQVDPKKRPSA
FEALKHPWLTYPYEPISA*

DNA
ATGGAGGATTCGAGCTCTATCGATTCGATTTTGGAATTTTTGCGGAAGAATCATTTTATGAGAGCTGAAGCTGCGTTGAT
TAGTGAGCTTTCTAAGAAACCAAGTTCAAATGGGTCTCTTCAAAAGCTTAACTTTGAGGATAATTGTGTGAGCAAGTTGT
TGGATAAGAAGAAGCAAGGCGGGAGTAGCCAAGCATTGGGTCTTCACAACGATAGTCACATTTCTGATGAATTGGTTGTG
AAAGAGATACAATGTGGAGCTGCCAATAACTTACACGAGAGTAATCTTATGAATGATGTTTCTGTTCAGACACAAAGTGG
TAATGCAGATTTTTGGGAGGAGAGATTCACGTTTGCTGAAGGATTTGAGGATACCGAGCTCGATTTACCTCCCTGGAACC
ATACCTCTACTGATATTGTAGCTGACTCTGAGGAATACAGTATCAATCCAAGTAAAAGAGGCTTTGTGAATCCACGGAGT
TCAAAGCAATCAAGTCATGAAAAGGTTCCTGAACCTGGTAAAAGCAATAAAGTGGTTGTGGAAGACGTCTTCTCTTCTTT
TGAGAAGATACGGACTGGAAGCTCTAGCCAGGTATCTCAGTATGACCATGGCAAAGCATGTCAATCTCTGGAAGTTGATA
ATAAGGTTGGGAACTCTGCAATACAAGAAGGATTCGTCACCACGTCATGGTCAAGAAGCGAAGAGAACATTGGTGCTTCA
CCAGACCATTGGAAGGATTGTTCTGTTACAACTGTTTTTCCGTTGTCCAAAGGAAGCACGTCAACAAAAGATAATGGTGT
AGCCATTTTAGATAAATGGCAAGGAAAGAAACTGGTTGGCGCGAGTGATTCCAGGATTCTTATCAAGGAGCAGGAAGATG
ATGTGGCAACAGCGCTATACCTTGGGAAGTCACAGTCTGGTTATGAACATAAGATTCCAAGCAGCTTAGCATTTTCGCTG
GCTCATGATGCTCCGAGGGAAGATTTACCTAGACTGCCACATGTAAAAATCAAGTCAGAGGATAAACTAATGAACTTTAC
TTGGGAAGAAAAACACGAGCGAGACATATTGGACGAGAAGCTGATTAATACTGATAATGCTTTCCTATTAGGCTCTTATC
TAGATGTTCCTATTGGACAAGAAATAAATTCATCAGGTGGCAAAATGGCTGGTGGAGGAAACTGGTTGTCTGTAAGTCAC
GGAATAGCAGACGATGCATCTGACTTGATTTTTGGCTTTGGCGATGGCTTAGGTGCTCTCAATGAACATTCAAATGAGTA
TTGGGACTCTGATGAATATGACGACGATGATGATGTTGGTTACATTAGGCAACCAATTGAGGATGAGGCATGGTTTTTGG
GTCACGAAGTCGACTATCCTAGTGATAATGAGAAAGGCACAGAGCACGGAAGTGTTCCTGATACGCAGGATAAAAGTCAA
ACCAAGAATGATGATGATCATTCATTTGCCGAGGAGGATTCTTATTTCTCCGGTGAGCAATATGTACTCGCTAAAGGCAT
TGAGCCAGTTACTGCTTCCAATGATCCGATGGGTCTCTCAATGACTGAAACATACAGCACGACCAAGCAAGCTGATTTGG
TTGCTCGATATGACGGGCAATTGATGGATGCAGAGGAGCTAAGTTTGATGGACACTGAACCTGTGTGGAAGGGATTTGTC
AGCCATGAAAATGATGTAATTTTGTTGAAGAAAGGGAAAGTCGAGGACAACTCTGGTAGAATCTGTCGGAAGGATATCCG
CGCAGAAGATGATCGAAATGCTGCAGTTAGGTCAATTGGTGTAGGAATGAGCGATGATGTTGATGACAATGGGAGTATAA
TACCTGAATACTTTCCTGGAGAAGGTAGTGAATGGGATCTGGAGCTCCTTCCTTATCGCGGAGTTGGAGTTGCTGGTGTT
AAGCCTCCACCTGGTAAAGGTGCGAGTATGCTGCTTAAAAACTTTGCAGATGGTGGATTCTCATTTCCCTCTCCAGTAGC
TGATAGACAGAAGTCCCAGGATGATTCTGCAAACCCTGAATGGTCAAACCATTGCGATGCTGTTGTGAGAAATGAAAGTG
ATGAACCAAAGGGGCTAATCCAGTCCGATAGCATGATTGTCTCTTCGACAAAAAGATGCAGTGGCTCTTCTTCTGAAAGA
AATTTAAGAGACATGGATGATGAAAAGGTTGCGAGTTCAAGAAATTCTTCCCCATCCGCACTCTCCCATAGTTCTGATAC
TGGGAGAGAGCACAAAGAAGAAGATGAGGAAGAAACTAGTCATGGGCCTGAAGAAGATCCTGGGACCTCGTTCGAGGATG
AGGATGCCATCGTGGTCCAAGAGCAAGTAAGACAGATTCAAGCCCAAGAGCAGGATTTTGAGACCTTCAACCTGAAGATT
GTTCACAGGAAAAATAGGACTGGTTTTGAGGAGGATAAGAACTTCCATGTGGTTTTGAATTCTGTCATTGCTGGTCGTTA
CCATGTCACTGAGCATCTTGGATCAGCAGCTTTTAGCAAAGCAATACAAGCACATGACCTCCACACCGGCATTGATGTTT
GTGTAAAGATCATAAAGAACAACAAAGACTTTTTTGATCAAAGCCTTGATGAGATCAAACTTCTCAAGTATGTCAACCAG
CATGATCCTGCTGACAAATATCATCTCCTTCGACTGTATGACTACTTCTACTTCCGGGAGCACCTGTTAATAGTATGTGA
ACTTCTCAAGGCAAACTTGTATGAGTTCCAAAAGTTTAATAGGGAATCAGGGGGAGAGGTTTATTTCACTATGCCAAGAT
TGCAGTCAATTACTATCCAGTGCTTGGAAGCATTGAACTTTCTGCATGGTCTCGGCCTTATACACTGCGACTTAAAACCT
GAAAACATACTAATCAAAAGCTACAGCAGATGCGAAATCAAAGTTATTGATCTGGGAAGTAGCTGTTTTGAGACAGATCA
TCTTTGCTCCTATGTCCAGTCTAGATCCTACCGTGCTCCAGAAGTCATTCTTGGGCTTCCATATGATAAAAAGATAGATA
TCTGGTCACTTGGCTGCATTTTGGCAGAACTATGTACCGGCAATGTTCTTTTCCAAAATGATTCTCCGGCTACTTTACTT
GCAAGGGTCATCGGTATAATCGGATCAATTGACCAAGAAATGCTTGCCAAAGGACGTGATACATGCAAGTACTTCACCAA
AAATCATTTACTATATGAGAGGAACCAGGAGAGTAACAATTTGGAGTACCTAATACCGAAAAAGTCATCGCTAAGGCGTA
GACTACCAATGGGTGACCAAGGCTTCATAGACTTTGTGGCATACTTGCTCCAAGTTGATCCAAAGAAACGCCCGTCTGCA
TTTGAAGCTCTTAAGCATCCTTGGTTGACTTATCCCTACGAACCCATATCTGCCTGA