Details for Arabidopsis Locus AT3G17712

Position : Chr3 ( 5`- 6056870 .. 6060287 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G17712

Protein [Map View]
MWVDYRTQHRPIHDPWHKKNTESVLFFPVDVMSNTPEDGDGAQVTTGGLFPVFPTSANSISAISNAPQWLRNASFTTDLS
VINAAASTAPSSSEVEAGDDEDEEGGADGNIGLANQARVYNLVEEEGSLESDDDKVKRKREKKKKRKSDNASDESRSRKS
DEYYSKPVKDYYLDTRPDPDNLAYGSIYRMNVPRYKLDNSQRVPGSGSLRFYLRNRRSSMLDTEIDIDSLEGRAKSDTRY
WYAKHAAMERNKNFKRIRLSAASEAVDSSFDNFIPLEEDVTVPESDEEDVLSKDSMIGASWEDEVLNKTREFNRVTRERP
HDAKAWLAFADFQDKVSSMQSQKGVRLQTLEKKISILEKAFELNPDSEELLLALLKAYRSRDNADVLIREFSRFKVSEVR
RLYSYAIQALSSACSKRHRQVDTTSEPLDSAAIQQELVLVDMLVSLCRFEWQAGYQELATALLQAEVEFSIFSPSLLLTE
QSKLRLFEHFWSSNGARVGEEGAFGWLLWLEKEEENRQKILKEESSDDNEVGGWTGWTEQVSGRNGDDLASANTGEVDVD
RKGLDEEMEDENSKPEDDTEAMLKLLGIDVNTAASDEVKDTSTWVEWFEEEVSRDHSQWMPTRKAGEFSSVEGMGEGEDE
EQLSSVVLYEDINGYLFSLRSKEARLSLVYQFIDFFGAHISPMDFQQQLSWSEKISSLETLSDSMLENLRSVHECLSKSD
SANCFSLGSLLGGSCDLSMRTEMMKFLRNAILLCLNVFPQNYIPEEAVLVTEELFVTNMKTCEDLLLCGVYAQREAASGN
MKHARRVFDMALTSICGLPKVSFRSFGYVVSGAYDTKFQVSTYVSNSEELLISFLC*

DNA
ATGTGGGTTGATTACAGAACACAGCATAGGCCTATTCACGATCCTTGGCACAAAAAAAATACAGAATCGGTTTTGTTTTT
TCCGGTGGATGTAATGTCGAATACACCAGAAGACGGCGACGGAGCACAGGTAACTACAGGCGGCTTGTTCCCCGTCTTCC
CTACTTCGGCGAACTCCATCTCAGCTATTTCGAATGCTCCTCAATGGCTTCGCAACGCTAGCTTCACTACGGATCTCTCT
GTCATCAACGCTGCCGCTTCGACGGCTCCTTCCTCATCCGAGGTCGAGGCTGGAGACGACGAAGATGAAGAAGGAGGAGC
TGATGGAAATATCGGTTTAGCTAATCAGGCTAGGGTTTATAATTTGGTTGAAGAAGAAGGGTCTTTGGAGTCTGATGACG
ACAAGGTAAAGAGGAAGCGAGAGAAAAAGAAGAAACGGAAGAGTGATAATGCTTCGGATGAATCTCGTTCTCGTAAATCT
GATGAATACTATTCGAAACCTGTGAAGGATTATTACTTGGACACTCGTCCTGATCCAGATAATCTGGCTTATGGCTCTAT
TTACAGGATGAATGTTCCTCGTTATAAACTTGACAATTCTCAGAGAGTTCCAGGGTCAGGTTCTCTGAGGTTTTATTTGC
GGAATCGACGTAGTTCTATGCTTGACACAGAGATTGATATTGATTCTTTGGAGGGGAGAGCAAAGTCTGATACCCGATAC
TGGTATGCAAAACATGCTGCCATGGAACGCAACAAGAATTTCAAGCGTATTCGTTTATCTGCTGCAAGTGAAGCTGTGGA
TTCTTCCTTTGATAATTTCATTCCACTGGAGGAAGACGTGACTGTTCCAGAAAGTGACGAAGAAGATGTTTTATCAAAGG
ACTCAATGATTGGAGCATCATGGGAGGATGAAGTGCTGAATAAAACACGGGAGTTCAACAGAGTGACGAGAGAACGTCCC
CATGATGCAAAGGCATGGCTGGCATTTGCTGATTTTCAAGACAAGGTTTCAAGTATGCAATCTCAGAAAGGAGTTCGCCT
GCAGACTTTAGAGAAAAAGATTAGTATACTTGAGAAGGCTTTTGAGCTGAACCCAGATAGCGAAGAACTGTTGCTTGCTC
TGCTCAAGGCATACCGAAGCAGAGACAACGCTGATGTACTAATCAGGGAGTTCTCCAGATTCAAAGTATCAGAAGTGAGG
AGGCTGTATTCTTATGCGATCCAGGCTCTTTCTTCTGCTTGCAGCAAGCGACATAGGCAGGTGGATACAACATCTGAACC
ATTGGATTCTGCTGCCATCCAACAGGAACTCGTTCTAGTCGATATGCTAGTTAGCCTCTGCAGGTTTGAGTGGCAGGCTG
GTTACCAGGAGCTGGCCACAGCGTTACTTCAAGCCGAAGTGGAATTTAGCATCTTTTCTCCATCTTTGTTGCTAACTGAA
CAGAGTAAATTACGACTGTTTGAGCACTTTTGGAGCAGTAATGGTGCTAGAGTTGGAGAAGAAGGAGCTTTTGGATGGCT
ATTGTGGCTGGAGAAAGAGGAGGAAAACAGGCAGAAAATTTTGAAAGAAGAATCCTCTGATGACAATGAAGTAGGTGGTT
GGACAGGTTGGACAGAACAGGTCTCAGGTAGAAATGGAGATGATCTTGCTTCAGCTAACACTGGAGAGGTCGATGTTGAT
CGGAAGGGTCTGGATGAGGAAATGGAAGACGAGAATAGCAAACCTGAAGATGACACCGAAGCTATGCTGAAATTATTGGG
CATTGATGTCAATACTGCGGCCAGTGATGAGGTTAAAGATACATCAACTTGGGTTGAATGGTTTGAAGAAGAGGTTTCTC
GAGATCACAGTCAATGGATGCCTACTCGGAAAGCTGGTGAATTCTCCAGTGTTGAGGGAATGGGTGAGGGAGAAGATGAA
GAGCAACTCTCAAGTGTTGTACTATATGAAGATATAAATGGATATCTATTTTCCTTACGTTCAAAGGAGGCCCGCTTATC
TCTGGTATACCAGTTCATTGATTTCTTCGGTGCACATATCTCCCCCATGGACTTCCAGCAACAGTTGTCGTGGAGTGAGA
AAATAAGTAGCCTTGAAACATTGTCAGATTCCATGTTAGAAAACTTGAGAAGTGTTCATGAATGTTTGTCGAAATCAGAT
AGTGCCAACTGTTTCAGCTTGGGATCTCTTCTAGGTGGCAGCTGTGACTTATCTATGCGGACTGAGATGATGAAGTTTCT
CCGCAATGCCATCTTGCTTTGTCTAAATGTTTTCCCGCAAAATTACATTCCCGAAGAAGCTGTGCTTGTTACAGAAGAAC
TATTTGTAACAAATATGAAAACATGTGAGGATCTACTACTTTGTGGAGTTTATGCACAGCGAGAAGCTGCCTCTGGAAAT
ATGAAACATGCAAGACGAGTATTCGACATGGCACTGACTTCTATCTGTGGCCTCCCTAAGGTTAGTTTCAGATCTTTCGG
TTATGTTGTTAGCGGAGCATATGATACAAAGTTTCAGGTTTCCACCTATGTCTCTAATTCCGAGGAACTTCTAATTAGCT
TTTTATGTTAG