Details for Arabidopsis Locus AT3G17690

Position : Chr3 ( 5`- 6045002 .. 6048488 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G17690

Protein [Map View]
MAHTRTFTSRNRSVSLSNPSFSIDGFDNSTVTLGYTGPLRTQRIRPPLVQMSGPIHSTRRTEPLFSPSPQESPDSSSTVD
VPPEDDFVFKNANLLRSGQLGMCNDPYCTTCPSYYNRQAAQLHTSRVSASRFRTVLYGDARGWAKRFASSVRRCLPGIMN
PHSKFVQVWTRVLAFSSLVAIFIDPLFFFLLLIQQDNKCIAIDWRATKVLVSLRSITDLIFFINILLQFRLAYVAPESRI
VGAGQLVDHPRKIARHYFRGKFLLDMFIVFPIPQIMILRIIPLHLGTRREESEKQILRATVLFQYIPKLYRLLPLLAGQT
STGFIFESAWANFVINLLTFMLAGHAVGSCWYLSALQRVKKCMLNAWNISADERRNLIDCARGSYASKSQRDLWRDNASV
NACFQENGYTYGIYLKAVNLTNESSFFTRFSYSLYWGFQQISTLAGNLSPSYSVGEVFFTMGIIGLGLLLFARLIGNMHN
FLQSLDRRRMEMMLRKRDVEQWMSHRRLPEDIRKRVREVERYTWAATRGVNEELLFENMPDDLQRDIRRHLFKFLKKVRI
FSLMDESVLDSIRERLKQRTYIRSSTVLHHRGLVEKMVFIVRGEMESIGEDGSVLPLSEGDVCGEELLTWCLSSINPDGT
RIKMPPKGLVSNRNVRCVTNVEAFSLSVADLEDVTSLFSRFLRSHRVQGAIRYESPYWRLRAAMQIQVAWRYRKRQLQRL
NTAHSNSNR*

DNA
ATGGCTCACACTAGGACTTTCACTTCCAGAAACCGTAGCGTTTCTCTCTCAAACCCATCTTTCTCCATTGACGGATTTGA
CAACTCAACTGTGACTTTAGGCTACACGGGTCCTCTTCGAACCCAGAGAATAAGACCTCCTTTAGTGCAAATGAGTGGTC
CTATTCACTCTACTCGCAGAACAGAACCTCTCTTCTCTCCTTCTCCTCAAGAATCTCCTGATTCCTCTTCTACCGTTGAT
GTTCCACCTGAAGATGATTTCGTCTTCAAAAACGCAAATCTCTTGAGATCTGGACAATTAGGGATGTGCAATGATCCTTA
CTGCACTACTTGCCCTTCTTACTACAACCGCCAAGCTGCTCAATTGCACACTTCCAGAGTTTCTGCCTCTAGGTTTCGCA
CTGTTCTGTATGGTGATGCTAGAGGTTGGGCTAAGCGATTTGCCTCCTCTGTTCGTAGATGCTTACCCGGAATAATGAAT
CCTCATTCCAAATTTGTTCAAGTCTGGACTAGAGTCTTAGCCTTTTCAAGCTTAGTGGCCATTTTTATAGACCCTCTCTT
CTTTTTCCTCTTATTGATCCAACAAGACAACAAATGCATAGCGATTGATTGGCGTGCGACTAAAGTATTGGTGTCTCTTA
GAAGTATAACGGATCTTATATTCTTCATTAACATTCTGCTTCAGTTTAGGTTGGCCTATGTAGCTCCTGAGTCTAGAATA
GTTGGTGCCGGCCAGTTAGTTGATCATCCAAGAAAAATTGCTCGCCATTACTTCCGAGGAAAGTTTCTCCTTGACATGTT
CATAGTCTTTCCCATTCCACAGATAATGATATTAAGGATAATACCATTACACTTAGGCACACGCAGGGAAGAATCTGAGA
AACAGATTTTACGCGCTACGGTTCTTTTTCAATACATTCCAAAGTTATATAGACTCTTACCTCTTCTTGCTGGACAAACA
TCTACTGGCTTCATATTTGAGTCAGCTTGGGCTAATTTTGTTATTAATCTTCTCACCTTCATGCTTGCTGGTCACGCTGT
TGGCTCTTGCTGGTATCTCTCTGCTCTGCAGAGAGTTAAGAAATGCATGCTGAATGCTTGGAATATTTCTGCGGATGAAC
GTAGAAATCTTATCGATTGTGCTCGTGGAAGTTATGCATCGAAGTCACAACGAGATCTGTGGAGAGATAATGCTAGTGTC
AATGCTTGTTTTCAAGAAAATGGTTATACCTATGGGATCTATTTGAAGGCAGTGAATCTTACCAATGAATCTAGTTTCTT
CACAAGATTCAGTTATTCTCTGTATTGGGGATTCCAACAAATAAGCACACTTGCTGGAAACTTATCCCCAAGTTACTCAG
TGGGTGAGGTTTTCTTTACAATGGGTATCATTGGACTAGGGCTTTTGCTTTTTGCGCGGCTTATCGGTAACATGCACAAC
TTCCTTCAATCACTTGATCGAAGGAGGATGGAAATGATGCTGAGAAAGCGTGATGTGGAGCAGTGGATGAGCCATAGACG
TTTGCCAGAAGATATAAGAAAGAGGGTGAGAGAGGTTGAGCGGTACACTTGGGCTGCGACAAGAGGAGTTAACGAAGAAT
TGCTATTTGAGAACATGCCTGATGACCTTCAAAGAGATATAAGAAGACACCTCTTCAAATTTCTCAAGAAGGTGAGAATA
TTTTCGTTGATGGATGAATCAGTTTTAGATTCAATCAGAGAGAGGCTGAAACAGAGGACTTACATAAGGAGTAGCACGGT
GTTGCATCACAGAGGTCTAGTAGAGAAAATGGTATTCATAGTGAGAGGTGAGATGGAGAGCATTGGAGAAGACGGTTCTG
TTCTTCCTTTATCAGAAGGAGACGTTTGTGGTGAAGAACTTCTCACTTGGTGCCTCTCTTCTATAAACCCCGATGGGACG
AGGATAAAGATGCCACCAAAGGGATTGGTTAGCAACAGAAATGTTAGGTGTGTGACAAACGTGGAGGCGTTTTCGCTGAG
TGTAGCAGATCTTGAAGATGTAACAAGCTTGTTTTCAAGATTCTTAAGAAGCCATCGAGTGCAAGGAGCTATAAGGTACG
AGTCTCCTTATTGGAGGTTACGAGCAGCTATGCAGATCCAAGTGGCTTGGAGATACCGAAAGAGACAACTCCAGAGATTA
AACACTGCTCACTCCAATTCCAACCGTTAA