Details for Arabidopsis Locus AT3G17680

Position : Chr3 ( 5`- 6042947 .. 6044504 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G17680

Protein [Map View]
MKNKASMEAPQLPSLSAFSHFQIFKSQSMLQKQWTPFFSLSLALFVFLSHHFLSEKMLETDLEARMQILRESGFQESQGD
DDTFAQRAEWFYQGRPLLLSLCLDLYNGYVTLLGRSSHQTRLKPTTSLPNQLLQDDDDCISDIDSVSEVSSEVESTLSFQ
QMKDPTAVSEKVDELVSQLVTASLDKEILKHELLHKDQQFHEASKTIELLKKFVMLLEMEKEVAVEENANLGYKLTSLLE
ENRELATEALFMKNEAVGLARCVLKMRDDHFHKVCILQNRIYSLQASRNSEPVSDKVSYGCFGLDKHKTKKKKENKTEEK
KPGFKWLKKLNTINLFTKCSLNPSAAAPSCCTFDLPY*

DNA
ATGAAGAACAAAGCATCCATGGAAGCTCCACAGTTGCCATCTCTCTCTGCTTTTTCACATTTTCAAATTTTCAAATCACA
AAGCATGCTACAGAAACAGTGGACCCCCTTTTTCTCTCTCTCTCTTGCTCTGTTTGTCTTTCTCTCTCATCACTTCTTGT
CTGAAAAAATGTTGGAAACAGACCTTGAAGCTCGGATGCAAATCCTGCGTGAGTCTGGTTTTCAAGAAAGCCAAGGAGAT
GATGATACCTTTGCTCAACGAGCTGAATGGTTTTACCAGGGACGACCTTTGCTTCTCTCACTTTGTCTGGACCTGTACAA
CGGCTACGTCACTCTCTTGGGTCGTTCTTCTCATCAGACCAGACTTAAACCCACTACTTCTCTTCCGAACCAGCTTCTCC
AAGATGATGATGACTGCATTTCGGACATTGATTCCGTTAGTGAGGTCAGTTCTGAAGTTGAGAGCACCTTATCCTTTCAA
CAGATGAAAGATCCTACTGCGGTTTCTGAGAAAGTCGATGAGCTTGTATCCCAACTTGTGACAGCAAGCTTGGACAAAGA
GATTCTGAAACACGAGTTACTTCACAAGGACCAACAGTTTCATGAAGCCTCCAAGACTATAGAGCTGTTGAAGAAGTTTG
TCATGTTGCTGGAGATGGAGAAAGAAGTGGCTGTGGAGGAAAACGCTAATCTTGGCTACAAACTCACTTCTCTCTTGGAG
GAGAACAGAGAGCTAGCCACTGAGGCATTGTTCATGAAGAACGAAGCTGTTGGGCTTGCTAGGTGTGTGCTTAAGATGAG
AGATGACCACTTTCACAAGGTCTGCATTCTCCAGAACCGCATCTACTCGCTTCAGGCATCTAGGAACTCAGAGCCCGTCT
CTGATAAGGTCTCATACGGATGCTTTGGCCTGGATAAGCATAAGACCAAAAAGAAGAAGGAGAACAAAACCGAAGAGAAG
AAGCCTGGATTCAAGTGGTTGAAGAAACTGAACACCATTAACCTGTTTACAAAGTGCAGCCTTAACCCATCGGCTGCTGC
TCCATCATGCTGCACTTTCGACTTGCCTTATTAG