Details for Arabidopsis Locus AT3G17670

Position : Chr3 ( 5`- 6040820 .. 6042588 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G17670

Protein [Map View]
MSSVALPAMSCRSSGEQVKEIRVCTNRTCRRQGSFQILETLTALAPPELRVTHCACLGRCGSGPNLVALPQGLILRHCAT
PSRAAEILFSLCGDGREASSSSAVTDALTALALTNNALSQIDAGNFSEAEALLTQALELKPYGGLHRIFKHRSVAKLGML
DYSGALEDISQALALAPNYSEPYICQGDVYVAKGQYDLAEKSYLTCLEIDPSLRRSKPFKARIAKLQQKVVELDLNTVEE
ERQT*

DNA
ATGTCTTCCGTCGCTTTGCCGGCGATGAGCTGCCGGAGCTCAGGTGAACAAGTGAAGGAGATTCGCGTTTGTACGAATCG
CACCTGCCGAAGACAAGGCTCCTTCCAGATTCTCGAGACTTTAACAGCTCTCGCACCTCCCGAACTCCGAGTCACTCACT
GCGCTTGCCTCGGCCGATGCGGCTCCGGTCCAAACCTCGTGGCTCTCCCTCAAGGTCTCATCCTACGTCACTGCGCCACG
CCTTCTCGAGCTGCTGAAATTTTGTTCAGCCTATGTGGTGACGGTCGTGAAGCTTCTTCATCCTCCGCCGTCACAGACGC
TCTCACGGCTTTAGCGTTAACCAACAATGCTCTCTCTCAAATCGATGCGGGAAATTTCTCTGAAGCCGAAGCACTTCTCA
CTCAGGCTTTAGAGCTGAAACCCTACGGTGGCTTGCATAGAATATTCAAACACAGATCAGTAGCAAAATTGGGAATGCTT
GATTACTCTGGGGCTCTTGAAGATATAAGCCAAGCTCTAGCTTTAGCTCCTAACTATTCTGAGCCCTACATATGCCAAGG
GGATGTCTACGTAGCAAAAGGTCAATATGATCTTGCAGAGAAGTCATACTTGACATGTCTAGAGATAGATCCTTCTCTTC
GCAGATCGAAACCATTCAAGGCCCGGATTGCGAAACTTCAACAGAAAGTTGTTGAACTAGATTTGAATACTGTTGAAGAA
GAGAGACAGACTTAG