Details for Arabidopsis Locus AT3G17668

Position : Chr3 ( 5`- 6039603 .. 6040489 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G17668

Protein [Map View]
MAVNACLSPPEMMAVRPGEGVPNSKSTQGKTRLYLTKPSWIVRTQSGAKTCMKSKAKGRCVICHGSGRVDCFNCCGKGRT
NCVDVEMLPRGEWPKWCKSCGGSGLSDCSRCLGTGEYRYIMGFRFLNQNDDADPQ*

DNA
ATGGCGGTGAACGCGTGTCTATCTCCGCCGGAGATGATGGCTGTCCGGCCAGGGGAAGGCGTTCCGAATTCAAAATCTAC
GCAGGGAAAAACTAGGCTCTATCTCACCAAACCTTCATGGATAGTCAGAACTCAGTCTGGAGCTAAGACGTGTATGAAGT
CGAAGGCGAAAGGACGATGCGTAATCTGCCATGGAAGTGGAAGAGTCGATTGTTTCAATTGTTGTGGGAAAGGGAGGACT
AATTGTGTGGATGTGGAAATGCTTCCAAGAGGAGAATGGCCTAAATGGTGCAAGAGTTGTGGAGGGAGTGGATTAAGTGA
CTGTTCTCGCTGTCTTGGCACCGGAGAGTACAGATACATCATGGGTTTCCGCTTCTTAAACCAAAACGATGATGCCGATC
CACAATAA