Details for Arabidopsis Locus AT3G17640

Position : Chr3 ( 5`- 6032393 .. 6033583 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G17640

Protein [Map View]
MSYTFFLLLLSLVHSTFSSLAPTDRAALQSIRDSLTDMPGSAFFSSWDFTVPDPCSSFSGLTCSSRGRVTGLTLGPNLSG
SLSPSISILTHLTQLILYPGSVTGPLPPRFDSLPLLRVISLTRNRLTGPIPVSFSSLSNLHTLDLSYNQLSGSLPPFLTT
LPRLKVLVLASNHFSNNLKPVSSPLFHLDLKMNQISGQLPPAFPTTLRYLSLSGNSMQGTINAMEPLTELIYIDLSMNQF
TGAIPSSLFSPTISTMFLQRNNFTSIATSNATSLLPEGSIVDLSHNSISGELTPALVGAEALFLNNNRLTGDIPEEYVKS
LINGTTKQLFLQHNYFTRFPWNSGLQLPDSVSLCLSYNCMETDPVVGLSTCPIEVAPLLSRPASQCSRFYNHSSTG*

DNA
ATGAGCTACACTTTCTTTCTCCTTTTGCTCTCTCTTGTCCACTCCACTTTCTCTTCATTAGCTCCTACGGATCGAGCCGC
GCTCCAATCCATCAGAGACTCTTTAACCGACATGCCCGGTTCAGCCTTCTTCTCCTCTTGGGACTTCACAGTTCCTGACC
CTTGTTCCTCCTTCTCTGGCCTTACCTGCTCTTCTCGCGGCCGTGTCACCGGCTTAACTCTTGGCCCTAATCTCTCAGGC
TCTCTCTCCCCTTCCATCTCCATTCTAACCCACTTAACCCAACTCATTCTCTACCCCGGTTCAGTCACCGGTCCTCTCCC
TCCTCGGTTCGATTCCCTCCCTCTCCTTCGAGTCATTTCCTTAACAAGAAACCGTTTAACCGGTCCTATACCCGTATCTT
TCTCATCTCTCTCAAATCTCCACACTCTTGACCTTAGCTATAACCAACTCTCTGGCTCTCTCCCTCCTTTTCTCACCACT
CTTCCTCGACTCAAAGTCCTTGTTTTAGCCTCAAACCATTTCTCCAACAACCTTAAGCCTGTCTCTAGCCCATTGTTCCA
TTTAGACCTAAAGATGAACCAAATCTCCGGCCAACTCCCACCCGCTTTCCCGACTACTCTCCGGTACTTATCTCTATCCG
GAAACTCAATGCAGGGCACAATCAATGCCATGGAGCCATTAACAGAGCTAATATACATCGATCTAAGCATGAACCAATTT
ACCGGCGCAATCCCTAGCTCACTCTTTAGTCCCACAATCTCAACAATGTTCCTACAACGAAACAACTTCACATCCATTGC
CACCTCAAACGCCACGTCATTGTTACCTGAGGGCTCCATTGTTGATCTGAGCCATAACTCAATCTCCGGAGAGCTAACTC
CCGCGCTTGTCGGAGCAGAGGCTTTGTTCTTGAACAACAACCGTCTCACTGGAGACATTCCAGAGGAATACGTCAAGAGC
TTAATCAACGGTACAACAAAACAGCTCTTCTTGCAACATAACTACTTCACGAGATTCCCTTGGAACTCTGGTCTCCAACT
ACCAGACTCTGTTTCGCTCTGTTTGTCATATAACTGTATGGAGACAGATCCAGTCGTTGGTTTGTCCACGTGTCCGATCG
AAGTTGCACCTCTGCTCTCAAGACCTGCTTCACAATGTTCAAGATTCTATAATCACAGCTCCACTGGTTAA