Details for Arabidopsis Locus AT3G17611

Position : Chr3 ( 5`- 6024795 .. 6026443 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G17611

Protein [Map View]
MENFGEGRRSGGGMLPLLALSAVAEYYRLPWKPPVTASLLAANTLVYLRPAFIDPVIPHISEVWFNPHLIFKHKDLKRLF
LSAFYHVNEPHLVYNMMSLLWKGIKLETSMGSSEFASMVFTLIGMSQGVTLLLAKSLLLLFDYDRAYYNEYAVGFSGVLF
AMKVVLNSQAEDYSSVYGILVPTKYAAWAELILVQMFVPNASFLGHLGGILAGIIYLKLKGSYSGSDPVTMAVRGVSRLV
TWPLRFLNGMVRSRRRRITGRGRVGRGQTGIAGPGIWRCQSCTYDNSGWLSACEMCGSGRARGNGWSLNQGPALSSSNDL
PLDELRRRRVERFS*

DNA
ATGGAGAATTTTGGTGAAGGGAGAAGAAGTGGAGGCGGAATGTTGCCGTTGCTGGCTCTAAGCGCCGTCGCGGAGTACTA
TAGACTACCGTGGAAACCACCGGTGACGGCGAGTCTCCTGGCCGCGAACACTCTCGTTTATCTCAGGCCGGCGTTTATCG
ATCCCGTTATTCCTCACATCAGTGAGGTCTGGTTCAATCCTCACCTCATCTTCAAGCATAAGGACTTGAAGCGTTTATTT
CTATCAGCGTTCTACCATGTTAACGAGCCTCACTTAGTCTATAACATGATGTCACTTCTCTGGAAAGGTATCAAGCTTGA
GACATCAATGGGAAGCAGTGAGTTTGCTTCAATGGTCTTTACTCTTATTGGTATGTCTCAAGGAGTCACATTGTTGTTAG
CCAAATCGCTTCTTCTCTTGTTTGACTATGACAGAGCTTACTACAACGAGTATGCGGTTGGGTTCTCGGGTGTTCTCTTT
GCTATGAAAGTTGTTCTTAATTCTCAAGCTGAGGATTACTCAAGTGTGTATGGTATCTTGGTTCCAACAAAGTATGCTGC
TTGGGCAGAATTGATTCTAGTGCAGATGTTTGTACCTAACGCTTCGTTTCTTGGGCATTTGGGTGGAATCCTTGCTGGTA
TTATCTATTTGAAGCTGAAAGGTTCTTACTCAGGCTCAGATCCAGTCACTATGGCGGTTAGAGGTGTATCTCGATTGGTG
ACGTGGCCCTTGAGGTTTCTGAATGGTATGGTTAGGTCTCGGAGAAGGAGGATTACGGGGAGAGGAAGAGTGGGAAGAGG
TCAGACTGGGATAGCAGGACCTGGTATTTGGAGATGTCAGTCGTGTACATATGACAATTCTGGTTGGTTAAGTGCTTGCG
AGATGTGTGGCTCGGGACGGGCTAGAGGAAATGGATGGTCACTGAATCAGGGACCAGCACTTTCTTCTTCTAATGATCTC
CCTTTAGATGAGCTGCGCCGTCGAAGAGTAGAGAGGTTTAGTTGA