Details for Arabidopsis Locus AT3G17600

Position : Chr3 ( 5`- 6020025 .. 6021142 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G17600

Protein [Map View]
MEVSNSCSSFSSSSVDSTKPSPSESSVNLSLSLTFPSTSPQREARQDWPPIKSRLRDTLKGRRLLRRGDDTSLFVKVYME
GVPIGRKLDLCVFSGYESLLENLSHMFDTSIICGNRDRKHHVLTYEDKDGDWMMVGDIPWDMFLETVRRLKITRPERY*

DNA
ATGGAGGTCTCTAACTCTTGTTCTTCATTTTCTTCATCCTCTGTCGACAGTACTAAACCTTCTCCTTCTGAATCTTCTGT
TAATCTCTCCCTTAGTCTCACATTTCCTTCTACTTCTCCACAAAGAGAAGCAAGACAAGATTGGCCACCGATAAAGTCTA
GATTAAGAGATACACTAAAGGGTCGTCGTCTTCTTCGTCGTGGTGATGACACTTCTCTCTTTGTTAAGGTTTATATGGAA
GGTGTTCCCATTGGAAGAAAACTCGACCTTTGCGTATTCTCAGGCTACGAGAGTCTATTAGAAAATCTCTCTCACATGTT
CGATACTTCAATCATCTGCGGTAATCGAGATCGAAAACATCATGTTTTGACATATGAAGACAAGGATGGAGATTGGATGA
TGGTCGGAGATATTCCATGGGATATGTTTCTTGAAACCGTGAGAAGACTAAAGATCACGAGACCGGAGAGGTATTAA