Details for Arabidopsis Locus AT3G17590

Position : Chr3 ( 5`- 6017212 .. 6019666 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G17590

Protein [Map View]
MKGLVSTGWKGPVKFRIYRPTAENLVPIRLDIQFEGQRYKDAFTWNPSDPDNEVVIFAKRTVKDLKLPYAFVTQIAQSIQ
SQLSDFRAYEGQDMYTGEKIIPIKLDLRVNHTLIKDQFLWDLNNFESDPEEFARTLCKDLGVEDPEVGPAVAFAIREQLY
EIAIQSVASARESRLSKKGRRGSDHGSASKASGLSMDLMKLFSFKSSVVRKRKDLDVYEPVVDLLTSEEVDALEAREERH
AR*

DNA
ATGAAGGGTTTAGTGTCTACTGGTTGGAAAGGTCCCGTCAAGTTCAGGATCTATAGGCCCACTGCTGAAAACTTGGTACC
TATTCGATTGGACATTCAATTCGAAGGTCAGCGTTACAAAGATGCTTTCACTTGGAACCCTTCAGACCCGGATAATGAAG
TCGTTATCTTTGCCAAAAGAACTGTTAAAGACTTGAAACTTCCCTATGCATTTGTCACTCAGATTGCCCAATCTATTCAG
TCTCAGCTCTCAGACTTTCGGGCTTATGAAGGACAAGACATGTACACTGGTGAAAAAATCATACCAATTAAGCTTGATCT
CCGAGTTAACCATACTCTCATCAAGGATCAGTTCTTATGGGACCTAAACAATTTTGAGAGTGATCCTGAGGAATTTGCAA
GAACCTTGTGCAAGGATTTAGGTGTTGAAGACCCTGAAGTTGGACCTGCTGTTGCCTTTGCAATAAGGGAACAACTTTAC
GAGATTGCAATTCAAAGTGTGGCTTCAGCTAGGGAGAGTAGATTAAGCAAGAAAGGCCGCAGAGGATCTGATCATGGTTC
AGCGAGCAAGGCAAGTGGCCTGTCAATGGACTTAATGAAGTTATTCAGTTTTAAGTCCAGTGTAGTTCGGAAAAGGAAAG
ACTTGGATGTTTATGAACCAGTTGTGGATCTGCTAACAAGTGAGGAAGTTGATGCGCTTGAAGCCAGGGAAGAGAGACAT
GCAAGGTGA