Details for Arabidopsis Locus AT3G17580

Position : Chr3 ( 5`- 6015184 .. 6015850 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G17580

Protein [Map View]
MASWKKTIATPFKKAATFFNQPQQSPKKGCRGRMDAQAREEHEKRMVQELQGEVMACGYDDVLVMWSILDKSNSSNNLSS
*

DNA
ATGGCATCATGGAAGAAAACAATCGCAACACCATTCAAGAAAGCGGCAACATTCTTCAACCAACCTCAACAATCACCAAA
GAAGGGTTGCCGTGGAAGAATGGATGCGCAAGCCAGGGAAGAGCACGAGAAGAGAATGGTTCAAGAGCTTCAAGGAGAAG
TCATGGCTTGTGGTTACGACGACGTCCTCGTCATGTGGTCTATTCTTGACAAATCTAACTCCTCAAATAACCTCTCTTCT
TAA