Details for Arabidopsis Locus AT3G17560

Position : Chr3 ( 5`- 6006762 .. 6008003 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G17560

Protein [Map View]
MRSEITRETKLLFDLPQDVIEEIFSKVPVTCLRRIRSTCKRLYALLKDRGFIRKHFAKSARQYHALMLKNFRFYSVSFNP
NGTEMDVASLFNGERSLIDPYSSSEAIISQAFHCDGLLLCTTKENRLVVLNPFSGQTKWLQPQNRCKIDEAYVLGYDNSD
LCHSYKILSFPDLYEQELETIKNAGRDLDVTPEGDLELKTDDFSSNSWRRNLGVTPHGGLGLKIYDFSSNSWKKLDVITP
EGCLKSYGVSLKGNAYWVYMSKRRGVNDYSLLSFDFSTESFQHLCVPFHQEADCFGTMALSVVREEHLSLLYQSCETLKV
EIWMTKEIDTTFVSWKKFLTVDLEPHLPHLLMFSCRMSFFIDEEKKVAVCCDRDNKVHVVGEDEYRVSSGFYFLDFEGIT
CCLTVFGYVPRLV*

DNA
ATGAGGTCAGAAATCACAAGAGAAACAAAGTTGCTCTTCGATCTTCCACAGGATGTGATAGAAGAGATATTCTCTAAGGT
TCCGGTGACATGTCTAAGAAGAATACGATCTACTTGCAAAAGATTGTACGCTTTACTCAAAGATCGTGGATTCATCAGAA
AACATTTTGCTAAATCAGCAAGGCAGTACCATGCTCTTATGCTAAAGAATTTTAGGTTTTATTCAGTGAGCTTCAATCCT
AATGGAACTGAGATGGACGTGGCTTCCTTGTTTAATGGTGAACGTAGCCTAATCGACCCCTATAGTAGTTCAGAAGCTAT
TATATCTCAAGCCTTTCACTGTGATGGTTTATTGCTATGCACCACCAAGGAAAACCGATTAGTGGTTTTGAACCCGTTTT
CAGGGCAAACCAAATGGTTGCAACCACAAAATCGTTGTAAGATAGATGAGGCCTATGTTCTTGGATACGACAACAGTGAC
TTGTGCCATAGCTACAAAATCTTGAGTTTTCCGGATCTATACGAACAAGAATTGGAAACTATCAAGAATGCAGGGAGGGA
TCTTGATGTCACTCCCGAAGGCGACTTAGAATTGAAAACCGATGATTTTAGCTCTAATTCATGGAGGAGAAATCTTGGTG
TCACTCCCCACGGCGGCTTAGGATTGAAAATATATGATTTTAGCTCTAATTCATGGAAGAAACTTGATGTCATCACTCCC
GAAGGTTGCTTAAAATCTTATGGTGTGTCACTGAAGGGAAATGCTTATTGGGTGTACATGTCTAAACGAAGAGGAGTCAA
CGACTACTCTCTACTTAGTTTTGATTTTTCAACAGAGAGTTTTCAACATTTGTGTGTTCCCTTTCATCAGGAAGCAGATT
GTTTTGGTACTATGGCTCTCTCAGTTGTTAGAGAAGAACATCTTTCGTTGTTATATCAGAGTTGCGAGACTCTAAAGGTG
GAAATATGGATGACCAAAGAGATTGATACAACATTTGTGTCATGGAAAAAGTTCTTAACAGTGGATTTAGAACCTCATCT
ACCTCATCTCCTTATGTTTTCGTGTCGCATGAGTTTCTTCATCGACGAGGAGAAGAAAGTTGCCGTGTGTTGTGACAGAG
ATAACAAGGTACACGTTGTTGGAGAAGATGAATACAGAGTATCTTCTGGTTTTTATTTTCTAGATTTTGAAGGCATAACA
TGTTGCCTGACTGTCTTTGGTTATGTTCCAAGATTGGTTTGA